KEGG   Peptostreptococcaceae bacterium oral taxon 929: C3V37_06950Help
Entry
C3V37_06950       CDS       T05383                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
pbq  Peptostreptococcaceae bacterium oral taxon 929
Pathway
pbq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pbq01100  Metabolic pathways
pbq01110  Biosynthesis of secondary metabolites
pbq01130  Biosynthesis of antibiotics
pbq01230  Biosynthesis of amino acids
Module
pbq_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pbq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C3V37_06950
Enzymes [BR:pbq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     C3V37_06950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: AVM67587
UniProt: A0A2P1G5L9
LinkDB All DBs
Position
1452565..1453572
Genome map
AA seq 335 aa AA seqDB search
MNKDELSYEIKIIHKASEIILEKKFTKHLVLTDRNLYREQRAFIDEIVKKYNAYIYVIDA
GEETKSLSVLENILEYASDKLDRHSIIINVGGGVVTDIGGFAASILYRGIKHVNVATSLL
AMTDAAIGSKTGIDFCNKKNILGTFYDPYKVFIAIDALKTLPKDEYISGFAEVIKHALIY
NDELYDLIKNDANIEEILEKSIWTKVHFVCEDKNEKGARMSLNFGHTFGHVIEAASGFAL
SHGHSVATGMKIALELGKILNITDEETYMRSFELIHKYYPIEEINYEIKSLKSDKKMMGD
EINFVFLKNKEALIQKMDERKVVELYNEHIKNKKF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagatgaactttcttatgaaataaaaattattcacaaggcgagtgaaattatt
ttagagaaaaaatttactaagcaccttgtattaacagatagaaatctttatagagagcaa
agagcttttattgatgagatagttaaaaaatataatgcatacatctatgtgatagatgcg
ggtgaagagacgaaaagtcttagcgttttggaaaatattcttgagtacgcatctgataag
cttgataggcactcaattataatcaatgtgggcggcggcgtagtaacggacattggcggc
tttgcagcttcgattctttatagaggcataaagcatgtaaacgttgcaacaagcctactt
gctatgacagacgcagccatcggttcaaagactggcatagatttttgcaataaaaaaaat
attttaggcacattttatgatccatacaaagttttcatagccatagatgcgcttaaaacg
cttcctaaagatgagtatatatcaggttttgcagaagtgattaaacatgcacttatttat
aatgatgaattatatgatttaattaaaaatgatgcaaatattgaagaaattttagaaaaa
tccatttggacaaaagttcattttgtttgtgaagacaaaaatgagaagggtgctcgcatg
tcgctaaattttggccacacctttggtcacgtgattgaagcagcaagcggatttgctcta
tcacatggccatagcgttgccactgggatgaagattgctcttgagcttggcaaaatttta
aatattacagatgaagaaacttatatgaggagttttgaattaattcataaatattatcca
atcgaagaaataaattatgagataaaatcacttaaaagtgataaaaagatgatgggtgac
gaaataaactttgtttttttgaaaaataaagaggcacttatacaaaaaatggacgagaga
aaggtagtagagctttataatgagcatattaagaataaaaaattctaa

DBGET integrated database retrieval system