KEGG   Parvularcula bermudensis: PB2503_01237Help
Entry
PB2503_01237      CDS       T01298                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PB2503_01237
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pbr02000]
    PB2503_01237
Enzymes [BR:pbr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PB2503_01237
Transporters [BR:pbr02000]
 Other Transporters
  Pores ion channels [TC:1]
   PB2503_01237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: ADM08327
UniProt: E0TBC3
LinkDB All DBs
Position
complement(154726..155361)
Genome map
AA seq 211 aa AA seqDB search
MALDFYTNPMSRGQIVRWMLEESGLPYEEKIVAYGPEMKGENYRQINPMGKVPAIVHEGR
IVTECAAICVYLAEMAQEADLAPHPDERADYYRWIFFAAGPVEAAVTTRAMGFSPQPDQE
VMAGFGNYDLTMSVLEGALSGRDYLCGARFTAADVYVGSQVDWGLTFGTIPSRPAFDTYA
ARLRDRPAYKRAKARDQALIEAQNQAQGPQN
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcactcgatttttacacgaacccgatgtcgcgcggtcaaatcgtccggtggatgttg
gaggaaagcggtcttccctatgaggaaaagatcgttgcgtacggccctgagatgaagggc
gaaaattatcgccaaatcaatccgatgggaaaggttcctgccatcgttcatgaggggagg
atcgtgacggaatgcgccgccatttgcgtctatcttgcggagatggcgcaagaggcggat
ctcgcgccgcatccggatgagcgggcggactattatcgctggatcttctttgccgcgggg
ccggtggaggcggcggtgaccacccgcgccatggggttctccccacagcccgatcaagaa
gtcatggccggctttggcaattatgatctcacaatgtcggtccttgagggggccttgagc
gggcgcgactatttgtgtggcgcgcgatttacggccgctgatgtctatgttgggtcccag
gtcgattgggggctgacctttggcacgatcccgtcgcgcccggccttcgacacttatgcg
gccagattgagggaccgtccggcctataagcgcgccaaggcgcgtgatcaggcattgatc
gaagcgcaaaatcaggcccaaggcccgcaaaactga

DBGET integrated database retrieval system