KEGG   Parvularcula bermudensis: PB2503_02347Help
Entry
PB2503_02347      CDS       T01298                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00970  Aminoacyl-tRNA biosynthesis
pbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PB2503_02347
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pbr03029]
    PB2503_02347
Enzymes [BR:pbr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PB2503_02347
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PB2503_02347
Mitochondrial biogenesis [BR:pbr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PB2503_02347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: ADM08547
UniProt: E0TCB4
LinkDB All DBs
Position
complement(396847..398313)
Genome map
AA seq 488 aa AA seqDB search
MSERPLKYLQGETGEWEVVIGLEVHAQVASNAKLFSGASAQYGAGPNENVSLVDAAFPGM
LPVINRYCVEQAVRTGLGLNAKINLWSRFDRKNYFYPDLPQGYQISQYKDPIVGEGMIEV
ELDDGETVEIGIERLHLEQDAGKSIHDLSPKESYVDLNRSGVALMEIVSKPDMRSAEEGA
AYFSKLRTILRYLGTCDGNMEQGSMRADVNVSVRRPGDALGTRTETKNVNSIRFVRQVID
YEARRQIEVLEAGGTIDQETRLFDVKTGETRTMRTKEDAHDYRYFPDPDLLPLELEEAMI
ERIRAELPELPDQKKRRFVDAYGLSVYDASVLAADREKADYFETVADGRDGKLAANWVTT
ELFAVLNKRDLTIAESPVPAAHLGELIDLIQDGTISGKIAKQVFEIMLDEGGAPRAIVDE
RGLKQVTDTGAIEAAVDKVIAENPAQVEKVKEKPKTLGWFVGQVMKETGGKANPQAVNAI
LKEKLGVE
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacggccattgaaatatttgcaaggcgagacaggcgagtgggaggtcgtgatc
ggccttgaggtgcacgcgcaggtcgcctcgaatgccaagctattttccggggcctccgcg
caatatggggctgggccgaatgagaatgtcagcctcgtcgacgcggcgtttcctgggatg
ttgcccgtgatcaaccgctattgcgtggagcaggcggtcagaaccggtcttggcctcaat
gccaagatcaatctatggtcgcgtttcgatcggaagaattacttctatcccgacctgccg
caaggttaccaaatcagtcagtataaggatcctattgttggtgaggggatgatcgaggtt
gaactcgacgatggcgaaacggtagaaatcgggattgaacgccttcacctcgaacaggat
gccggcaagtcgatccacgacctttcgccgaaggaaagctatgtcgacctcaaccgctca
ggggtcgcgttgatggaaatcgtctccaagcccgatatgcggtcagcggaagagggcgcg
gcctatttttcgaaactgcggacgatcctcagatatctggggacctgtgacgggaatatg
gagcaagggtcgatgcgcgccgatgtcaacgtttcggtgcgccggccgggcgacgcgctc
ggcacccggacggagaccaagaacgtcaactccattcggtttgtccgtcaagtgatcgat
tatgaggcccggcgtcagatcgaggttctcgaagcgggcggcacgatcgatcaggaaacc
cggttgttcgacgtcaagacgggtgaaacgcggaccatgcgcaccaaggaggatgcccat
gattatcgctattttcctgacccggatcttctgcccctcgaacttgaagaggcgatgatc
gagcggatccgtgctgagttaccggaactcccggatcagaaaaaacgtcgttttgtcgac
gcctatggcctgtccgtctatgacgcttcggttcttgccgcggatcgggagaaggcggat
tatttcgagacggtggctgacgggcgagacggcaagctggcggccaattgggtgacaacg
gaactgtttgccgttctcaataaacgggatctcactattgccgagagcccggtccccgcc
gcgcatttgggggaattgatcgatttgatccaggacgggacaatttcgggcaaaatcgct
aaacaggtttttgagatcatgttggatgagggcggtgccccccgggccatcgtcgacgaa
cgcggtctgaaacaggtcacggataccggcgcgatcgaggcggcggtcgacaaggtgatt
gcggagaatccggcgcaggtcgaaaaagtcaaagaaaagccgaagaccctggggtggttc
gttggccaggtgatgaaagagaccggcggcaaagccaatccgcaggcggtcaatgcgatc
ctcaaggaaaagctcggcgtggaatag

DBGET integrated database retrieval system