KEGG   Parvularcula bermudensis: PB2503_03767Help
Entry
PB2503_03767      CDS       T01298                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00061  Fatty acid biosynthesis
pbr01100  Metabolic pathways
pbr01212  Fatty acid metabolism
Module
pbr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PB2503_03767
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pbr01004]
    PB2503_03767
Enzymes [BR:pbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PB2503_03767
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     PB2503_03767
Lipid biosynthesis proteins [BR:pbr01004]
 Fatty acid synthase
  Component type
   PB2503_03767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ADM08828
UniProt: E0TE07
LinkDB All DBs
Position
682339..682887
Genome map
AA seq 182 aa AA seqDB search
MSETTPTSERRHSYDKEALIECGMHGLRGPGTAQLPVPPMLMFDRILSITEDGGKHGKGQ
VIAELDITPDLWFFECHFPGDPVMPGCLGLDALWQLVGFFLTWGGSPGHGRALGAGQIKF
SGQVQPSVSLVRYEIDIRRAMRGRLILGIADGVMFADDVPIYKASDLRVGLFSQDQLSAT
GL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaacgaccccgacgtccgaacggcgacactcctacgataaggaagccttgatc
gagtgcggcatgcacggtctgcgcggtccgggaacggcccaattgcctgtccccccgatg
ctgatgttcgaccggatcctctcgatcactgaggatggcggcaagcatggtaaaggccag
gtcatcgccgagctcgatatcacccctgacctctggttctttgaatgccatttcccgggc
gaccccgtcatgcccgggtgcctcggcctcgatgccctgtggcagcttgtgggcttcttc
ctgacctgggggggcagcccaggtcacgggcgggccctgggggcggggcagatcaaattt
tccggtcaggtccaaccctctgtcagcctggttcgctacgagatcgatatacgtcgcgca
atgcgcggtcgtctcatcctcggaatcgcagacggggtgatgtttgcggatgacgtgcct
atctacaaggcatcggatttgcgggttggcctgtttagtcaggaccaattgtcggcaacc
ggcctttag

DBGET integrated database retrieval system