KEGG   Parvularcula bermudensis: PB2503_06547Help
Entry
PB2503_06547      CDS       T01298                                 

Definition
(GenBank) manganese superoxide dismutase Mn-SOD
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pbr  Parvularcula bermudensis
Brite
Enzymes [BR:pbr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PB2503_06547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADM09375
UniProt: E0TI36
LinkDB All DBs
Position
1271905..1272513
Genome map
AA seq 202 aa AA seqDB search
MAISLMDLPYEKTALAPHISEDTLNYHHGKHHQAYVTKTNDAIKGTALDDADLEAIVKEA
KKTANQGLFNNSAQVWNHNIYWQSMSPNGGGAPKAGSKIAEAIDKSFGSYDEFKAKFKDA
GGTQFGSGWAWLVAKKDGSLEILKTLNADCPLTDESVTTLLTMDVWEHAYYLDYQNARPD
YMTHFLDNLVNWDFAEERLAAA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggccatttcattgatggacttaccctacgagaaaacggcgctggcgccgcatatttct
gaggacacgctcaactatcaccacggcaagcaccaccaggcctatgtgaccaagaccaat
gacgcgatcaaagggacggccctcgacgatgccgatctcgaagcgattgtgaaggaagcg
aaaaagaccgccaatcaggggctgttcaacaattcagcacaggtctggaaccacaatatc
tattggcaatccatgagccccaatggcggcggcgcgccgaaggcgggaagcaagatcgcc
gaagccatcgataagagctttggatcgtacgatgagttcaaagcgaaattcaaagatgcg
ggtgggacgcaatttggatccggctgggcctggctcgtggcgaaaaaggacggcagcctg
gagatcctgaaaacgctgaacgccgattgtcccctcaccgatgagagtgtgacgacgctt
ctcaccatggatgtgtgggagcacgcctattatctcgattatcaaaatgcgcgtcctgac
tatatgacgcatttcctcgacaatctggtgaattgggatttcgcggaagagcgccttgcc
gcggcctga

DBGET integrated database retrieval system