KEGG   Parvularcula bermudensis: PB2503_12714Help
Entry
PB2503_12714      CDS       T01298                                 

Definition
(GenBank) threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00260  Glycine, serine and threonine metabolism
pbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PB2503_12714
Enzymes [BR:pbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     PB2503_12714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADM10580
UniProt: E0TFM0
LinkDB All DBs
Position
2594295..2595320
Genome map
AA seq 341 aa AA seqDB search
MKALVKAHAEPGIWLQTVPEPEIGATDVLIKVKKTAICGTDIHIYEWDDWAQSTIPVPLT
IGHEFMGEVVAVGSDVTNVALGDRVSAEGHITCGVCRNCRAGKRHLCRNALGLGVSRAGA
FAEFVAVPAFNIYHLPDAVSDELGAIFDPFGNAVHTALSYDLVGEDVLITGAGPIGAMAA
AIARFVGARHIVVTDINDFRLDLAAQMGATRTVNIGREALPDVMAELGMTEGFDVGLEMS
GAAAGFRDMLDTMNHGGKIALLGLLPKGTGIDWSKVIFKGLDLKGIYGRRLFETWYKMGA
LTQSGLDLSPIITHRLPIEDFENGFEIMRSGRSGKIVLEWP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattggtcaaagcgcacgcagagccgggaatttggctgcaaaccgttcccgag
cctgagatcggcgcgaccgatgtgctgatcaaggtcaaaaagaccgccatttgcggcact
gacatccacatctacgaatgggatgactgggctcagtcgacaatccccgtgccgttgacc
atcggccatgaatttatgggggaggtggtcgccgtcggatcagatgtgacgaatgtcgcc
cttggcgaccgggtctcggccgaggggcacatcacctgcggtgtctgccgcaactgtcgg
gcgggaaagcgccatttatgccgcaacgcgcttggccttggggtcagtcgagccggtgcc
tttgccgagttcgtcgccgtcccggcgttcaatatctatcacctgcccgatgcggtgtcg
gacgaattaggggcgattttcgacccgttcggcaacgccgtacacaccgccctgtcatac
gatcttgtcggcgaagatgtcctcatcaccggcgccgggccgatcggcgcaatggccgcc
gcgatcgcgcggttcgttggtgcccgtcatattgttgtaacggatatcaacgacttccga
ctggatctggctgcgcaaatgggggcaacacgaacggttaatatcggccgcgaggcactg
cccgacgtgatggccgagcttggcatgacagaagggttcgatgtggggcttgagatgtca
ggcgccgcagcaggctttcgcgacatgctggacaccatgaaccatgggggcaagatcgcc
ctattgggtcttttgccgaagggcacggggatcgactggtcaaaggtcatcttcaagggg
ctcgacctcaaggggatctatggccgccgcctattcgagacctggtacaagatgggggcg
ctcacccaatccggcctcgatctctcccccatcatcacccatcgcctgccgattgaggat
ttcgagaatggctttgagattatgcgctctggccgctcggggaaaatcgtcctcgaatgg
ccatga

DBGET integrated database retrieval system