KEGG   Pectobacterium brasiliense: B5S52_09530
Entry
B5S52_09530       CDS       T06364                                 

Definition
(GenBank) integrating conjugative element protein
Organism
pbra  Pectobacterium brasiliense
SSDB
Motif
Pfam: UPF0242 DUF2046 SLX9 CENP-F_leu_zip Golgin_A5 ZapB Crescentin FUSC YabA DUF4407
Other DBs
NCBI-ProteinID: ARA76098
LinkDB
Position
complement(2077866..2079272)
AA seq 468 aa
MRSNGLLKWLMIPVALLVLFVGIRLFSGGGTQSSATAETGSQLTPEEMKALGIEGDTPRD
TVATLVAQVRQLRTELQTATTDNRAQREENQRLRQRESAIDQRISTTLESERASLRRDQE
QLNNERQQTEGLLADLQRRQDSIGNAGHGDLPVGLGLRDGDAEGFSDEATIRWVEPDDAR
QTDGRHGNAALNFPTRFGPAQKTLDTTVESVTSTRTNATRANPARAVYTVPTNSTLMGSV
AMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGIDIPDVAGAVFSGTASGDWTLSCVRG
QVRSITFVFHDGTIRTIPQDSERSNQQSNDQNGLGWISDPYGIPCVSGERRSNAQQYLGT
QALITAAGAGAASLIDSDSGQMSYAGADGSIGTVGISSNEAVGRILAGGVRDMSDWVNKL
YGQAFAAVYVKPGAHVAVHLEKPLAIDYDTEGRKVDHRTGESHAFELD
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgcgcagtaatggtctgttgaaatggctgatgatccccgtcgcactgctggtcctgttc
gttggcatccgcctgttctctggtggcggcacacagtcctctgccacggcagagacgggc
agccagctcaccccggaggaaatgaaggcgctgggcatcgaaggggacacaccacgcgat
actgtcgcgacgctggtggcccaggttcggcaactgcgcactgagctacaaaccgccacc
accgacaaccgggcacaacgagaagaaaaccagcgtctgcgtcaacgtgaaagtgccatt
gaccagcgtatcagtaccacactggaatccgagcgggccagccttcgccgcgaccaggag
caactcaacaacgagcgccaacaaactgagggtctgctggcagatttgcaacggcggcag
gacagtatcggcaacgccggtcacggcgacctgccagtcggccttggcctgcgagacggg
gatgctgaaggattcagcgacgaggccacgatccgctgggtagagcctgatgatgccaga
cagactgatggccgtcatggcaacgctgcgctgaactttccgacacgtttcgggcccgcc
cagaagacgctggacaccacggtcgaaagcgtcaccagtacccgcacaaacgcgaccaga
gccaaccccgccagggccgtttacaccgtcccaaccaattcaacactgatgggttcagtc
gcgatgacagccttgattggccgcgtaccgatcgacggcaccgtcaatgacccttaccct
ttcaaagtcttggtcggccccgacaatctgacggccaacggcatcgatatccctgatgtg
gctggcgctgtgttcagtggcaccgcgtccggcgactggacgctctcgtgcgtcagggga
caggtacgctcaatcaccttcgttttccacgacggcaccatccgcaccattccgcaagac
agcgaacgcagtaatcagcaaagcaatgaccagaacggtctcgggtggatcagtgatccc
tacggtatcccgtgcgtgtccggcgagcgccgcagcaatgcccagcagtatctcggtaca
caggctttgatcaccgcagcaggcgcaggcgcggcatccctcatcgattcggacagcggt
cagatgtcctacgccggtgccgacggctccatcggcaccgtgggcatcagcagcaacgag
gctgtgggccgcattcttgccggcggcgtacgtgacatgtctgactgggtcaacaaactc
tatggccaggccttcgcagcagtctatgtgaagccaggcgcacacgtcgccgttcacctc
gaaaaaccgctcgccattgactacgacaccgaaggccgcaaggtcgaccatcgtactgga
gaaagccatgcgttcgaactggactaa

DBGET integrated database retrieval system