KEGG   Pectobacterium brasiliense: B5S52_09595
Entry
B5S52_09595       CDS       T06364                                 

Definition
(GenBank) lytic transglycosylase
Organism
pbra  Pectobacterium brasiliense
SSDB
Motif
Pfam: SLT Glucosaminidase SLT_3
Other DBs
NCBI-ProteinID: ARA76111
LinkDB
Position
complement(2089229..2089819)
AA seq 196 aa
MAASALTSMQRRWTLLVSILMAGLAQAQEIPPPAYQLAAQRAGVPSVVLYAVALQESGVR
RAERIVPWPWSLNVAGQSRRYTSQAQACAGVHQALQDVPLTRIDVGLGQINLGWQKHRYR
QPCDLLDPYNNLTIAAQILKEQHIPGEDWLLAMGRYHRPAGGAPAARYRRSVSQHLQRVL
GPQQTVPTTLSKETTP
NT seq 591 nt   +upstreamnt  +downstreamnt
atggcagcgtcagccctgacatccatgcaacgaaggtggacgttgctggtaagcatactg
atggctggcctggctcaggcccaggagatccccccaccggcctaccagttggcagctcaa
cgcgcgggtgttccctctgtcgtcctttatgcagtggcgttgcaggaaagtggtgtgcgc
cgtgcagaacgtatcgtgccgtggccgtggtcgctgaatgtggcaggccagtctcgccga
tacaccagccaggctcaggcctgtgcaggagtacaccaggccctgcaagacgtaccactt
acccgcattgacgtgggcctgggacagatcaatctcggttggcaaaagcaccgctaccgc
cagccctgcgacttactcgatccgtacaacaacctgacgatcgcggcacagatcctcaag
gagcagcatatccccggcgaagactggctgctggcaatgggtcgctaccaccgacctgct
ggcggtgcgcctgcggcacgctaccggcgcagtgtgtcgcaacaccttcaacgtgtattg
gggccgcagcaaactgtccccaccactctcagcaaggaaaccaccccatga

DBGET integrated database retrieval system