KEGG   Rubinisphaera brasiliensis: Plabr_1028
Entry
Plabr_1028        CDS       T01431                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
pbs  Rubinisphaera brasiliensis
Pathway
pbs00620  Pyruvate metabolism
pbs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Plabr_1028
Enzymes [BR:pbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     Plabr_1028
SSDB
Other DBs
NCBI-ProteinID: ADY58649
UniProt: F0SJW0
LinkDB
Position
1190704..1194231
AA seq 1175 aa
MKSKQADVVETYGLDRERSLGFLSDEVHPEEYQRRLYLHANLQLLASDLPTPPSADRSGL
HDVVSSLLENYKEKNRLLRQNRKPVDRRIENFLDRQFRTLFLKERPKLPDQTIVLDRHGM
ARMLSLPAHGDTYRNDLVNSYRVKNGVLHNPRHDRRTTKGTFHVVEGGLPIADDKKIVPK
AVFAKLFKVAMNPPDKYLELPFTSELEEPAKTFVSLYLRPLVCPEVPGVSPHKSMEIRFF
APGSLVSNLDFVESIFGNAGDPLLPENDAALDVVHWSGHTGCVVLAPQMSECTKKDLGLP
HWDDATPRQQRDGMCYKEEDELYNDGQAFKLTCRTDEGTVVTLIADNYFGYCKKEVKTQI
SYAANLYGNAEEEHAGGALTFRSYSLGEKFQANSVQYNGQRFEDVVRNYADFVDARPEGY
GVDKIFPELIYIPEDAHATLHGQRITWTQNGEERSIPLLPGRVYMAPSGYQIRMEKHPQA
PSWRLIGTVADGIFCHKPCTVSGGGKSEISKSLVDYMHYGPLFVSDLENDFAEIEKIINK
QDFHLRWRDDSTDKPNYSDRASRPIFGPQRSLGSVIKLLTPSLEYNDDYNNWLKSIPDYL
LSLLFIIKRFEEEGWEHDWAEHFGVDLVNGHPGHELKFRDRTLVGTYLRVGFLGPRKWRT
FKLRQDFSPAQKIQTEDDISVSQVVASEQVAHLSDFERGHSVKFVTNCEYRLFQRPDEAI
HRGFDKQAEADIAGPDNFISNFEPLTKEDVQRMADSVADFDAFSLPMQNLLNNMLDDENS
EYVVCSANPRKVNGVPTKNPRYLQSRPDMVDAFPRYVTQRGLQLNRKIPANEFVPFPVHA
VLMGRRNNPPDKQAGIHSLAVYNPIHYQELPELFMDLICSLTGKSPSTTGFGSEGALTKG
PFNALRYAADLNAAFVSHVLTGLAGFSSAAGHIGPDVQVDHDVSLLIPEIWCRLEPHEQD
PEYLIKEGSLEKMEDVEYNGEIIPVSRLGYRITRRFVRNYFGRVFDHPATVFDEAILKPE
MQDEEAFYDGVKYICESHKKVASQYLEDGTFDELIPPLQALIRIMIDGEFEGKKISDPEL
RQMFTKEYVLESDWYQQRLKAKQKVDQNLMGRHLAYLDSWLEMPENQKVAERLDVAERRK
WVKTQLDLIGSDGYRERLKGTIGVQPNLVGNPTEE
NT seq 3528 nt   +upstreamnt  +downstreamnt
atgaagtcaaagcaagctgatgttgtcgaaacctacggactcgatcgggaacgatcgctc
ggatttctctccgatgaagtacacccggaggaatatcagcggcggctttatctgcacgcc
aatctgcagttgctggcctccgacctgcccactccgccgtcggccgaccgctccggcttg
cacgatgtcgtcagctccctgctggaaaactacaaagagaagaaccggctgctgcgacag
aatcgtaagcctgtcgatcgccgcatcgagaacttcctcgaccgccagttccgcactctg
ttcctgaaagaacggcccaaacttcccgatcagaccatcgttctcgatcgtcacggcatg
gcccgcatgctgtcgctgcccgcccatggcgatacctatcgcaatgacctggtcaattcc
taccgggtgaagaacggcgtgctgcacaatccgcggcacgatcgccgcaccaccaaagga
actttccacgtcgtggaaggtggcctgcccatcgccgacgacaaaaaaatcgtccccaaa
gccgtcttcgccaagctcttcaaagtggcgatgaacccgccggacaaatacctggaactg
ccattcaccagcgaactggaagaaccggccaagacgtttgtgtctttgtacctgcggccg
ctcgtctgtccggaagttcccggcgtctctcctcacaaaagcatggagattcgcttcttc
gcgcccggctcgctggtcagcaacctcgactttgtcgaatcaattttcgggaacgccggc
gatccgctgctgcctgaaaacgacgccgccctggacgtagtccactggagcggacatacc
ggctgcgttgttctcgccccgcaaatgtcggaatgcacgaagaaagatctcggcctgccg
cattgggacgacgccacgccacgtcagcagcgcgacggcatgtgctacaaagaagaggac
gagctttacaacgacggccaggctttcaaactgacctgccgtaccgatgaaggaaccgtt
gtcacgctgatcgccgataactacttcggttactgcaaaaaagaagtgaaaacgcagatc
agctacgccgccaacctgtacggcaacgccgaagaagagcatgcgggcggagcgttgaca
ttccgcagctacagcctgggcgaaaagtttcaggccaacagcgtgcagtacaacggccag
cgttttgaagacgttgtgcgtaactatgccgatttcgttgatgcccgccccgaaggttac
ggcgtcgacaaaatcttccccgagctgatctacattccagaagatgcccacgcaacgctt
cacggccagcgcatcacctggacgcagaacggcgaagaacgcagcattccgctactgccc
ggcagggtttacatggctcccagcggataccagatccgcatggaaaaacacccgcaggct
cccagctggcggttgatcggaaccgtggccgacggcatcttctgccacaaaccatgcacc
gtgagtggtggcgggaaaagcgaaatcagcaagtcgctggttgactacatgcactacggc
ccgctgttcgtttccgatctggaaaacgacttcgccgaaatcgaaaagatcatcaacaag
caggacttccacctgcgttggcgcgatgattccaccgacaaaccgaactactccgaccgt
gcttcccggcccatcttcggaccgcagcggtcgctcgggagtgtcatcaaactgttgacc
ccgtcgctcgaatacaacgacgattacaacaactggctgaagtcgatccccgactatctg
ctttcgctgctgttcatcatcaaacggttcgaagaagaaggctgggaacacgactgggcc
gagcatttcggcgtcgacctggtcaacgggcatcccggccacgaactcaagttccgcgac
cgtacgctggtcggaacctatctgcgtgttggtttcctgggaccacgcaaatggcggacg
ttcaaactgcgtcaggacttctcaccggctcagaaaatccagaccgaagacgacatcagc
gtctctcaggttgtggccagcgagcaggtggcccacctcagcgatttcgaacgcgggcac
agcgtgaagttcgtcaccaactgcgaataccggttgttccagcgtcccgatgaagcgatt
catcgcggcttcgacaaacaggccgaagctgacatcgccggcccggataacttcatctcc
aacttcgagccgctcaccaaagaagacgtgcagcggatggccgattccgtcgccgacttc
gacgcgttcagcctgccaatgcagaatctgctgaataacatgctcgacgacgaaaacagc
gagtacgtcgtctgctccgccaatccccgtaaggtgaacggcgtgccgacgaagaacccg
cgttatctgcagtcgcgaccggacatggttgatgccttcccgcgttatgtcacccagcgt
ggactgcaattgaaccgcaaaatccccgccaacgaattcgtgccgttcccagtgcacgca
gtgttgatgggccgccgtaacaatccgccggacaaacaggccggcatccactctctcgcg
gtttacaacccgattcactaccaggaactgccagaactgtttatggacctgatctgctcg
ttgaccggcaaaagcccatcaacgaccggtttcggtagcgaaggggcactcacgaaaggc
ccgttcaacgcgctgcgttacgctgccgacctgaacgccgccttcgtcagccatgtgctg
accggtctggcagggttctcctctgcagctgggcacattggaccggacgtgcaggtcgac
cacgatgtcagcctgttgattccggaaatctggtgtcgcctcgagccgcatgagcaggat
ccggaatacctgatcaaagagggcagcctcgaaaaaatggaagacgtggaatacaacggc
gaaattattcccgtctcccgtcttggttaccgtatcacccgccgctttgtgcggaactac
ttcggtcgtgtgttcgatcacccggccacggtgttcgacgaagcaatcctcaagccggaa
atgcaggacgaggaagccttctacgacggcgtgaagtacatctgcgaatcgcacaagaaa
gtcgccagccagtacctggaagacggcacgttcgacgagctgattccgccgctgcaggct
ttgatccgtatcatgatcgacggcgaattcgaaggaaagaaaatttccgaccccgaactt
cgccagatgttcaccaaagaatacgtcctcgaaagcgactggtatcaacagcggttgaaa
gccaaacagaaagtcgaccagaacctgatgggtcgccatctggcttacctcgacagctgg
ctcgaaatgccggaaaaccagaaagtcgcagaacgcctcgacgtggccgagcgtcgcaaa
tgggtgaaaacccagctcgacctgatcggcagcgacggctatcgcgaacggctgaaagga
accatcggcgtgcaaccgaatctggtcggcaacccgacggaagagtaa

DBGET integrated database retrieval system