KEGG   Fermentimonas caenicola: ING2E5B_0297Help
Entry
ING2E5B_0297      CDS       T03818                                 

Definition
(GenBank) hypothetical protein
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pbt  Fermentimonas caenicola
Pathway
pbt00473  D-Alanine metabolism
pbt01100  Metabolic pathways
pbt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pbt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ING2E5B_0297
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ING2E5B_0297
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pbt01011]
    ING2E5B_0297
Enzymes [BR:pbt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ING2E5B_0297
Peptidoglycan biosynthesis and degradation proteins [BR:pbt01011]
 Precursor biosynthesis
  Racemase
   ING2E5B_0297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase
Motif
Other DBs
NCBI-ProteinID: CEA15066
UniProt: A0A098BY24
LinkDB All DBs
Position
chrI:326800..329268
Genome map
AA seq 822 aa AA seqDB search
MKYEIKEIASTLGVSSSNLNYSEITTLLTDSRKITDPSKTLFFALESKNNDAHNYISELY
ASGVRNFVVSKQRNEWKDLKGANFFKVRNCLSALQKLAQHHRSKFNIPIIGITGSNGKTV
VKEWLYQLLEKDYNIVRSPRSYNSQIGVPLSVWQLDNDAELGIFEAGISKPDEMENLEPI
IRPTIGVLTKIGDAHQENFDSLQQKTLEKLELFKNCEVFVYDEDNELVSSCVDLKVLSQK
TFSWSRKNREAHLFISDIEKLENSTKIEYSFLNFYYSFEIPFIDDASIENAINCLAIALY
LHVSPNEISERMSTLEPVAMRLDVRKGKHGSLIINDSYNSDVNSIKIALDFQHQRKMDRK
LKKTLILSDILQSGVPPKRLYKRVADMAEQSGIERIIGIGKDILANADLFTMPDKTFFLT
TDDFLKSCIQDSFRDELILLKGARRFNFERINNILEERIHETVLEVDLDAVVHNFNFYKS
KLNSNVKLVCMVKANAYGAGAVEIAKTLQYHRCDYLAVAVAEEAVTLRNEGISLPIIVLN
PEVNGFEELITNNLEPEVYNMRILESFINNSERSGITNYPIHLKIDTGMHRLGFLPEQIE
ELVETLKKQKGLRVSSIFSHLSASESWSFDDFTHQQMETFRAAAQKIENELGYSVHKHIL
NSAGIERFNDYEWDMARLGIGLYGVSPSGLSGLKNVCTLKSTILQIKKISSNETIGYGRK
EKLDHDARIATIRFGYADGMDRQFGNRKGKVLINGQNAPIVGNVCMDLSMVDVTDIKAEE
GDTVVLFGEGLPVTDLAESIGTIPYEILTSVSPRVKRVYIKE
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgaaataaaagaaattgcatctactcttggagtttcatcaagtaatcttaat
tattccgaaataaccacactcttaacggatagcagaaagattacagacccatcaaagact
ctcttttttgctctggaatcaaagaataacgatgctcacaattatataagtgaattgtat
gcatcgggggtgcgtaattttgttgtttccaaacaacgaaacgaatggaaagatctcaaa
ggtgcaaactttttcaaagtaaggaattgcctgtctgcattacaaaagctggctcagcat
cacagatcaaaatttaatatacctattataggtataaccggaagtaatggtaaaacagtt
gttaaagagtggttatatcagttattggaaaaagattataatattgttcgttctccaaga
agttacaactctcagataggagtgccactttcggtatggcaactcgataatgatgcagaa
ctgggaatatttgaagcggggatatccaaacctgacgaaatggagaacctggaaccaata
atcagacctactattggggtgttaactaaaataggggatgcacatcaggaaaatttcgac
tcacttcagcagaaaactctcgagaaacttgagctcttcaaaaattgtgaggtctttgtt
tatgatgaggacaatgaactggtgagtagttgtgtcgaccttaaagtgctatctcagaag
accttctcatggtcaagaaaaaacagagaagctcatctttttatttcagatattgagaaa
ttagaaaatagcactaagattgaatattcattcctgaatttttactacagctttgaaata
cctttcatagatgatgcatcaatagaaaatgcaattaattgtcttgcaattgcactatat
cttcatgtgtcacccaatgagatttcagaacgtatgagtacacttgagcctgttgcgatg
agacttgatgtccgtaaaggcaagcatggttcactaatcataaatgacagctataactct
gatgtgaactcaatcaagattgctcttgattttcagcatcagcgtaaaatggatcgtaaa
ttaaaaaaaactcttatcctgtcagatattcttcagtcgggtgttccaccaaagcgactt
tataaaagagttgctgacatggcagagcaaagtgggatagaaagaataataggtattgga
aaagatattcttgcaaatgctgatctgttcacaatgcctgataaaactttcttcttaact
actgatgattttctcaagtcatgtattcaagactcatttcgggatgagctgattcttctt
aaaggtgcaaggagatttaacttcgaaagaatcaacaatattctggaagagagaattcat
gaaaccgtacttgaggttgatcttgatgcagtggtgcacaattttaatttctataaatct
aagctcaactccaatgtaaagctggtatgtatggtcaaagccaatgcatatggtgcagga
gccgtagaaatagcaaagactctgcagtatcatagatgcgattatctcgcagttgctgtg
gcagaggaggcagtcacacttagaaatgaaggtatatcacttccaataatagttctcaat
ccagaggtaaatggctttgaagagctgattacgaataatctggagccagaagtttataat
atgcgcatacttgagagttttataaataattcagaaagaagcggtataactaattatcca
attcacctgaaaatagatacaggtatgcatcgcctggggttccttcctgagcaaatagag
gagcttgttgagactctaaagaagcagaaggggcttagggttagctccatattttcacac
ctctcagccagtgagagttggtctttcgatgatttcacacatcagcagatggaaactttc
agagccgctgcacaaaaaattgagaatgaacttggatacagtgtgcataaacatatactt
aactctgcaggtattgagcgttttaatgactatgagtgggatatggcacgattgggtatc
ggtctgtatggtgtcagcccaagtggtctttccggactcaagaatgtttgcactttaaaa
agcacaatactgcagattaaaaagatatcaagtaatgagaccattggttacggtagaaag
gaaaagctggaccatgatgcccggatcgctacaataagatttggatatgcagatggtatg
gaccgacagtttggaaatagaaaaggtaaagtacttataaacgggcagaatgcacctatt
gtgggaaatgtatgtatggacctctctatggttgatgttaccgatataaaagcagaagag
ggtgatactgttgtactgttcggagaagggttaccggttactgatttagccgagagtatt
ggaacaatcccgtatgaaatacttacttctgtttctccacgtgtgaaacgtgtttatata
aaggaataa

DBGET integrated database retrieval system