KEGG   Fermentimonas caenicola: ING2E5B_0752Help
Entry
ING2E5B_0752      CDS       T03818                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pbt  Fermentimonas caenicola
Brite
KEGG Orthology (KO) [BR:pbt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ING2E5B_0752 (ahpF)
Enzymes [BR:pbt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ING2E5B_0752 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA HI0933_like DAO Thi4 Thioredoxin_3 NAD_binding_7 AlaDh_PNT_C NAD_binding_8 FAD_oxidored K_oxygenase FAD_binding_3 Glutaredoxin 3HCDH_N PSDC Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CEA15519
UniProt: A0A098BXX8
LinkDB All DBs
Position
chrI:800691..802247
Genome map
AA seq 518 aa AA seqDB search
MLDNSLKEQLKAIFANLKSEYQFDIYASQDHESYSELVELLEDVVASSPKFSLKINEGNY
IAFNLLKNGEETGVVFRGIPNGHEFTSLLLAVLNSDGKGKNQPDEFIRKRVESLKGKINL
TTYVSLTCTNCPDVVQALNLMAIINPDITHEMVDGAIYKEEVESLKIQAVPAVYADGELL
HVGRGEFGTLLTKLEEKYGVVEKETTDSEIRRFDVLVVGGGPAGASAAIYSARKGLNVAV
LAQTVGGQVKETTGIENMISVPQTTGEKLTVDLRKHMEEYPISILEHRIVEKVEVDGNEK
IVHVKGGERFATGALIIATGANWKKLNVPGEADHIGKGVAFCVHCDGPFYKDKHVAVIGG
GNSGIEAAIDLAAICSKVTVFEFLDELKADKVLQEKVASLPNVELFLSSQTMEVLGDGNK
VSGLKVKDRKTEEERVVDVDGVFIQIGLAPNSSVFKGVVNVNRFGEIETDSHCRTNVPGI
YAAGDVTTVPYKQIIISMGEGAKAALTAFDDRIRGVLS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaattcattaaaagaacaattaaaagcaatttttgcaaatttaaaatcagaa
tatcaatttgatatatatgcatctcaggatcatgaaagctatagtgaactggttgagctg
ctggaggatgtagttgcaagttcaccaaagttttctctgaaaataaatgaaggaaactac
attgcattcaatctgctgaaaaatggagaagagacaggtgtggtcttcagaggtataccc
aatggtcatgaatttacttcacttctgttggccgtgctgaatagtgatggcaaagggaaa
aatcaacctgacgaatttataagaaagagggtagaatcattaaagggaaagattaatctt
acaacttatgtttcactaacatgtacaaattgcccggatgttgtacaggcccttaatctc
atggcaattatcaatcctgatataacacatgagatggttgacggtgcaatttataaggag
gaggttgaatcattgaagattcaggctgtacctgctgtatatgctgatggagaactgctt
catgtgggcaggggtgaatttggaacactattgactaaacttgaagagaagtatggtgtt
gtagaaaaagagaccactgattcggaaatcaggaggtttgatgttttagttgtaggtgga
ggtcctgcaggcgcttctgcggcaatatactctgcacgaaaggggctgaatgtggcagtg
ctggctcagacagtaggaggacaggtaaaggaaactactggaatcgagaatatgatttca
gtaccccagacaactggagaaaaacttactgttgatcttagaaaacatatggaggagtat
cctatctcgattcttgagcatagaattgttgagaaagttgaggtagatggtaatgagaaa
attgtacatgttaaagggggtgagaggtttgcaactggtgctcttataattgcaactggt
gctaactggaaaaagcttaatgttcccggagaagctgatcatattggtaaaggggttgca
ttctgtgtgcattgtgacggaccgttttataaagataagcatgtagctgttataggtgga
ggaaactcaggtattgaggctgcaattgatttagctgcaatatgttcaaaggttactgta
tttgagtttcttgatgaacttaaagctgataaggtgctacaggagaaagttgcctctttg
ccaaatgtagagctgtttttaagctctcaaacaatggaggtgcttggcgatggtaataaa
gttagcggtttgaaagtgaaagacagaaaaactgaagaggagagggttgtagatgtagat
ggggtatttatacagatagggctagccccaaacagttctgtttttaaaggtgttgttaat
gttaacagattcggagaaatagagacagattctcattgtcgcactaatgttccgggtata
tatgcagcgggtgatgttacaactgtaccttacaagcagattataatctccatgggtgaa
ggagctaaagctgcccttactgcttttgatgacagaattagaggtgttttatcttaa

DBGET integrated database retrieval system