KEGG   Fermentimonas caenicola: ING2E5B_1544Help
Entry
ING2E5B_1544      CDS       T03818                                 

Definition
(GenBank) hypothetical protein
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
pbt  Fermentimonas caenicola
Pathway
pbt00500  Starch and sucrose metabolism
pbt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ING2E5B_1544
Enzymes [BR:pbt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ING2E5B_1544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 Glucos_trans_II
Motif
Other DBs
NCBI-ProteinID: CEA16292
UniProt: A0A098C321
LinkDB All DBs
Position
chrI:1724726..1726063
Genome map
AA seq 445 aa AA seqDB search
MKSICFYFQIHQPFRLKRYRFFNIGNDHYYFDDYSNEDIMQQIAARSYIPANRMLLDLIN
QYKGKFKVAFSISGVALDQMEVYAPEVIEGLRELSKTGDVEFLTETYAHSLSSLFDPEEF
HNQVKQHSERIEMLFDQKPTVLRNTELIYSDEIADMVYKMGYKKMITEGAKHVLGWKSPN
YVYQSASQPQLKLLLKNSKFSDDIAYKFSDYSWNEYPLTAEKFMSWIASTPPEEKVFNLF
MNYEVLGNLQPSHSGIFEFMKALPRFAFEKGIGFSTPSEIMDSHKPIGAIQVPETISWSD
EERDVSAWLGNRLQKSALKSLYEIGERVRLCTVRQLKQDWIYLQSSDHFYYMSTKHFGIG
NSNFSPYMSPYDAFNNYMNVLSDFIGRIKAQYPDTVDNEELNALLTTIHNQDMEIKRLEQ
ELKKVIGTNEELLVEKLSRKKADKI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgatttgcttttatttccagatacaccagccgttcaggctaaaaagatatcgt
ttctttaatataggaaacgatcactactattttgatgattattctaatgaagatataatg
caacagattgcggcaagatcctatataccggccaacaggatgttgctagatctgataaat
caatacaaaggaaagtttaaagttgcattttctatttcaggagtagctctggatcaaatg
gaagtttatgctccggaagtaattgaaggtttacgagaactaagcaaaaccggagatgtt
gagtttcttacagaaacatatgcccattcactatcgagtctttttgatcctgaagagttt
cacaatcaggttaaacaacattctgaaagaattgaaatgcttttcgatcagaagcctaca
gtattgcgaaatacagagttgatctattctgatgaaattgctgatatggtttataaaatg
ggatataagaaaatgattaccgaaggagccaaacatgtccttgggtggaaaagtcccaat
tatgtatatcaatcggcttcacagcctcaactaaaattactgctaaaaaacagcaaattt
agtgacgatatagcatataaattctccgattacagttggaacgagtaccccctgacagca
gaaaaattcatgtcatggatagcttcaactcctccggaagagaaagttttcaatctcttt
atgaattatgaggtattaggtaatctgcaaccctctcactccggaatatttgaattcatg
aaagcgctaccccgatttgcttttgaaaaaggaattggtttctctactccaagtgaaatt
atggattctcataagccaattggagcaattcaggttcccgagacaatctcatggtctgac
gaggagcgtgatgttagtgcatggttgggtaaccgacttcagaagagtgctttaaagtcg
ctttatgagattggcgaaagggtaagactttgcactgttcgtcagttaaaacaggactgg
atatacctgcaatcgagtgatcatttttattacatgtcaacgaagcattttggaatcggc
aatagtaattttagtccctatatgtccccctatgatgcattcaataattacatgaacgtt
ttaagtgattttataggtaggattaaagcccaatatcctgatactgtcgataatgaggag
ttgaatgctttacttacaacaattcataatcaggacatggaaataaagagacttgaacaa
gaacttaagaaagttattggaactaatgaagaattattagttgaaaaactttcaagaaaa
aaagctgataaaatatag

DBGET integrated database retrieval system