KEGG   Phycisphaerae bacterium L21-RPul-D3: L21SP3_01717Help
Entry
L21SP3_01717      CDS       T04695                                 

Gene name
mro_2
Definition
(GenBank) Aldose 1-epimerase precursor
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pbu  Phycisphaerae bacterium L21-RPul-D3
Pathway
pbu00010  Glycolysis / Gluconeogenesis
pbu00052  Galactose metabolism
pbu01100  Metabolic pathways
pbu01110  Biosynthesis of secondary metabolites
pbu01120  Microbial metabolism in diverse environments
pbu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pbu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L21SP3_01717 (mro_2)
   00052 Galactose metabolism
    L21SP3_01717 (mro_2)
Enzymes [BR:pbu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     L21SP3_01717 (mro_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AQQ09896
UniProt: A0A1Q2HRM2
LinkDB All DBs
Position
complement(2118249..2119418)
Genome map
AA seq 389 aa AA seqDB search
MLLRKLSILTLVLSVAVLSSCTETQKKDSPKKCPKQSLKPSIEKSYFGTTKDGQKVYEYM
LDNGKGMDAGIITYGGVMTYLNVPDKNGKSDDILLGFDNLKDFEEKSDYFNALIGRYGNR
IAKGKFELNGKTYTLATNNGENHLHGGDKGFDKRVWSATHSVTEDAANLTLTYLSKDGEE
GYPGSLRCVVTYSITADNELVIDYKAETDKATPVNLTQHNYYNLDGQGSGKILDHKLMIN
ASEITPVDEGLIPTGEIVDVYGPFDFTEPKKIGKHINSADIQMKYGKGYDHNFVLDKGKG
MGLAAKVYEPDSGRIMEVWTEEPGLQFYSGNFLDGTIVGKEGKRYVQRCAFCLETQHFPD
SPNKPQFPSTILEPGEVYNTKTIYKFKTK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgcgtaaactttcaatcttaacattagtgcttagcgttgcggtgctttcatca
tgcactgaaacccagaaaaaagactcacccaagaagtgtcccaagcagagcctcaagccc
tctattgagaagagctacttcggcaccaccaaagacgggcagaaggtgtacgagtatatg
ctcgataacggcaagggcatggatgcaggaataatcacctatggcggggttatgacttac
ctcaacgtacctgacaagaacggcaagagcgatgacattctcctcggcttcgataatctc
aaggatttcgaagagaagagcgattatttcaacgcccttatcggcagatacggcaaccgt
attgcaaaaggcaaattcgagctgaacggcaagacctacaccctcgccacaaataacggc
gagaaccacctacacggcggagacaagggcttcgacaagcgggtttggtctgctacgcat
tcagtaacagaagatgccgcaaacctcaccctaacctacctcagcaaagacggcgaggaa
ggatacccgggcagcctccgctgcgtggtaacatattcaataactgcagataatgagctt
gtaatagactacaaagccgaaacagacaaggctacaccggttaatctcactcagcacaac
tactacaacctcgatggacagggcagcgggaaaatcctcgaccataagcttatgatcaat
gcctcagagataactcctgttgatgaaggacttatccccaccggagagatcgtggatgtt
tacggccctttcgacttcacagagccaaagaaaatcggaaagcacataaactctgccgat
atccagatgaaatacggcaaaggctacgaccacaactttgttctcgataaaggcaaaggc
atggggctcgctgcaaaggtttacgaacccgacagcggcaggattatggaagtttggaca
gaagagcccgggctgcagttctacagcggcaatttcctcgacggaacaattgtgggcaag
gaaggcaaaagatacgttcagagatgcgcattctgccttgaaacccagcacttccccgat
tcaccgaataagcctcagttcccatctactatcctcgaaccgggagaggtttacaacaca
aaaacaatctacaaattcaaaactaaataa

DBGET integrated database retrieval system