KEGG   Paenibacillus bovis: AR543_09245Help
Entry
AR543_09245       CDS       T04407                                 

Definition
(GenBank) hypothetical protein
Organism
pbv  Paenibacillus bovis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_MLP1_2 IFT20 TMF_TATA_bd TMF_DNA_bd Atg14 ERM DUF3450 DUF1664
Motif
Other DBs
NCBI-ProteinID: ANF96163
UniProt: A0A172ZF86
LinkDB All DBs
Position
2179278..2182190
Genome map
AA seq 970 aa AA seqDB search
MTTNDRIRVTVNIYGTSYKLVGSSADYMKSVAQYVDEHMHSISQAHSHLDTTKLAILSAV
HMAEEAIQSSTERGELDTAIAEQQRLTAELERLQAVQQQQEEIIRKLQTEASEQQTEHQQ
LTARLTTAEKEVSQTREQLTQVQKQNQQLNEQNKQQQQSSQELRQQLDNAQKAAAAAQEQ
YRNLEQSTNKKLEQQQLDIMQSAENEEQLRLRSGELEEQLFTLQQEHDQAQQRKIQLEED
NDFLHAQLEEVRSKHTQLEKGMAEVREESETWRELSQQQEDELNRVQSEYTDLRQQQEQA
AQQLTTLTGQLDTERQEKEQLQSEIESTQQRYQDLEQRAEQLRTELSGQYEEQLGELRMQ
LTEAEQRRQELEDQLAAYMQQLEEARTLLTDTQEEAATWEQLSNQHEQEMQQLQQELSSI
RQEYAELQDQLSAREQQLEQLNTTTAEVREEAAVWQRLSEQHEDQLTQLKLELELAQQQR
DEQIGQLENQLSQLNLQRDDLTGQIELLQLQVEELTASATQSREEADTWQQNSVELEKEM
NELSSQRDNLAGQIELLRQQVEELTASAAQSREEADTWQQNSVELEREMNQLNSQRDDLA
GQIELLQQQAEELTASAAQSREEADTWQQSSAELEKEVQRLNEQEQQLQQQFAAAGEQVR
LLEDQLSGLQVESAGYQEEMNTWRELSTQQEEEVRHYQRELSIQQQRHTTLSGQLTEQEN
QLQQTRQEAADQLAAMRQEAAEQLASVRQESEQYMQELDTWRKLSRQQEQETLEVQSRLE
QQQRESEERIAALNAQIAELQHQHEQQASLLDETLQDVDSWNQRYARLEEDYRAVVLNEQ
GYMEEIGRLEQQSQQLRTELQQWQSRMEQISEQQRQQEQQLQELASSEQRWRTEYEQLQN
SRETSSQETREIMDQYEMMSHQLRLIHVERDTQLEEKERIQRELDVLREQHLQLQVEHNE
WLELIEQDQN
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacaaacgatcgaatccgagtcaccgttaatatctatgggacttcatataaattg
gttggcagcagtgccgactacatgaaaagtgtagctcagtatgtggatgagcacatgcac
agtatatcgcaagcccacagtcatctggatacgaccaagctggcgattctgtcagctgta
catatggcggaggaagcgatccaatccagcaccgagcgtggtgaactggatacggctatt
gcagagcagcagcgtctgactgcagagttggagcgtctccaggctgtccagcagcagcag
gaggagataatccggaagctgcaaaccgaagccagcgagcagcagacggaacatcagcag
ctgaccgctcgtctgacgacagccgaaaaggaagtatcccagactcgcgaacagctgacc
caggtacaaaagcagaatcagcagctgaacgagcagaacaagcagcagcagcaatccagc
caggagctgcgtcagcagctggacaatgcgcagaaagcggctgcagcagcgcaagagcag
tatcgtaatctggaacagagtacaaacaaaaagctggaacagcagcagctggatattatg
cagtctgccgagaatgaagagcagctgcgtctgcgtagcggagagctggaagagcagctg
tttacgttgcagcaggagcatgatcaggctcagcagcgcaaaattcaactggaggaagat
aacgactttttacatgcccagctggaagaagtacgctccaaacatactcagcttgagaaa
ggcatggccgaagttcgtgaagaatccgaaacttggcgtgaactgtcccagcagcaggaa
gacgagctgaaccgtgttcaaagcgaatatacagatcttcgccagcagcaggagcaggcg
gctcagcagctgactacactgacaggacagctggataccgagcggcaggaaaaggaacag
ctgcaatccgaaatcgaatccacgcagcagcgttatcaggatctggaacagcgtgcagaa
cagctgcgtaccgagttgtccggtcagtacgaggagcagctgggtgaactgcgtatgcag
cttaccgaagcggagcagcgccgtcaggaactggaagatcaactggcagcttatatgcag
cagctggaagaagcacgtactctgttgacagatacgcaggaggaagctgctacctgggaa
caactctccaatcagcatgaacaggagatgcagcagctgcagcaggaactgtcttcgatc
cgtcaggagtatgcagagctgcaggatcagctgagtgcccgtgagcagcagctggaacag
ctgaatacaactacagcagaagttcgggaagaagctgctgtatggcagcgtctgtcggaa
cagcatgaagatcagcttacccagctgaagctggaactggaattggcccagcagcaacgg
gatgaacagattggtcagttggaaaatcagttgtcccagctgaacttgcagcgagatgac
cttaccggtcagatcgaacttctgcaactacaggtagaagaactgacagcctctgctacc
caatcgcgtgaagaagccgatacctggcagcagaattcagtagagctggaaaaagaaatg
aacgagctgagctcacagcgagataatcttgccggacagatcgagcttctgcggcagcag
gtagaggaactgacagcctctgctgcgcagtcgcgtgaagaagccgatacctggcagcag
aattcagtagagctggaaagagaaatgaaccagctgaactcacagcgagatgatcttgcc
ggacagatcgagcttctgcagcagcaggcagaggaattaacagcctctgctgcgcagtcg
cgtgaagaagccgatacctggcagcagagttcggcagagctggaaaaggaagtacagcgt
ttgaacgagcaggagcaacagctgcagcagcagtttgcagcggccggggaacaggttcgc
ctgctggaagatcaattatccggattgcaggtcgagtctgccggatatcaggaagaaatg
aatacatggcgcgagctgtctacccagcaggaagaggaagttcgtcattatcagcgtgaa
ctgtctatacagcagcaacgtcacactacgctgtccggtcaattgaccgaacaggagaat
cagctgcagcaaacccgtcaggaagcagcggaccaattggctgccatgcgtcaagaagcg
gccgagcagctggcctctgtccgtcaggagagcgagcagtatatgcaggagctggatacc
tggcgcaagctgtccagacagcaagagcaggagactctggaggtacagtcccgtctggag
cagcagcagcgagaatcggaagaacgtattgctgcgttgaacgcgcagatcgccgaactg
cagcatcagcatgagcagcaggcttccctgctggacgagacgcttcaggatgtggacagc
tggaatcagcgttacgcccgtctggaagaagattaccgggcagttgtactgaatgaacag
ggctatatggaagagatcggacgcctggagcagcagagccagcagctgcggaccgaactg
cagcaatggcagtcccgcatggagcagatctccgagcagcagcgacagcaggaacaacag
ctgcaggagctggcgagcagtgagcagagatggcgtacagaatatgaacagctgcagaat
tctcgggaaacgagcagtcaggaaacccgggaaattatggatcaatacgaaatgatgtcc
caccagctacgtttgattcatgtggaacgcgatacccagctggaagaaaaagaacggatt
cagcgcgagctggatgttctgcgcgagcagcatctacagctgcaggtcgagcataatgaa
tggctggagctgattgagcaggatcagaactaa

DBGET integrated database retrieval system