KEGG   Paenibacillus bovis: AR543_09470Help
Entry
AR543_09470       CDS       T04407                                 

Definition
(GenBank) chemotaxis protein
  KO
K06595  heam-based aerotactic trancducer
Organism
pbv  Paenibacillus bovis
Brite
KEGG Orthology (KO) [BR:pbv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:pbv02035]
    AR543_09470
Bacterial motility proteins [BR:pbv02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    AR543_09470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Protoglobin MCPsignal PmbA_TldD SKA2 DUF1825 NES_C_h
Motif
Other DBs
NCBI-ProteinID: ANF96205
UniProt: A0A172ZEZ1
LinkDB All DBs
Position
2233193..2234212
Genome map
AA seq 339 aa AA seqDB search
MIQVSSQRRRQLEYIRLTDKDVQLLASYRTIFEKVVDEVVDYFYDHIDKYPDLKRVIQGN
GSSVHRLKQTQRDYWLSLAGGVINEEFIEHRLKIGKIHSRIGLNLDYYLGTYMTYTDIAA
RVLERELPDQWMPVLNALTRMFNLDSQLVLEAYGEQEQEQIREMADQKQHMLSSVTEVVD
RMSSMIVRLNENARDISDSAGHIAASQELSLQEMNSLGHEVKQISTVGSIMRELSDQTHL
LGLNASIEAAHAGEYGRGFSIVAQEVRKLAGSSQNALKDINGTLQVIMSRLNQVEESFKH
NVELSRQQAGSSQELATFAQMIEQVARELEELQQAEYSS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatacaggtttcatctcagcgccggcggcagctcgaatatatccgtttaacggataag
gacgtgcagctgctggcttcatatcgcacaatttttgaaaaagtggttgatgaagtagtc
gactatttttatgatcatatcgataagtatccggatctgaagcgtgttatccagggcaat
ggatcatcggtgcatcgtctcaagcagacgcagcgcgattattggctttcgcttgccgga
ggcgtgattaatgaggagtttattgagcatcgtctcaaaatcggcaaaattcattcccgg
atcggattgaatctggattattatctgggtacgtacatgacttacaccgatatcgctgca
cgggtattggaacgggaactgccggatcagtggatgcctgtactgaacgcactgacacgc
atgttcaatctggattcccagctggtgctggaagcctacggagaacaggagcaggagcag
attcgggaaatggcagatcagaagcagcatatgctgtcatcggtgaccgaagtggtcgac
cggatgagcagcatgattgtacggctgaacgagaatgcacgtgacatttccgattcggca
gggcatatcgccgcctcccaggaattatccctgcaggaaatgaacagtctgggccatgaa
gtcaagcagatcagcacggtaggctccattatgcgcgagctgtcggatcagacgcatctg
ctcggtctcaatgcttctattgaagctgcccatgccggggagtatggacgtggattcagt
attgtcgctcaggaggtgcgcaagctggcaggttcttcccaaaatgcattgaaagatatt
aacggtacgctgcaagtcattatgtcgcgtctgaatcaggtcgaagaaagcttcaagcat
aatgtggaattgtcgcgccagcaggctggcagttcgcaggaactggctacttttgcccag
atgattgaacaggtagcacgcgagctggaggaacttcagcaggccgaatatagcagctga

DBGET integrated database retrieval system