KEGG   Paenibacillus bovis: AR543_14675Help
Entry
AR543_14675       CDS       T04407                                 

Definition
(GenBank) alpha amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pbv  Paenibacillus bovis
Pathway
pbv00500  Starch and sucrose metabolism
pbv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AR543_14675
Enzymes [BR:pbv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AR543_14675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase CBM_25 CBM53 Malt_amylase_C hDGE_amylase Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: ANF97123
UniProt: A0A172ZHV5
LinkDB All DBs
Position
3474166..3475986
Genome map
AA seq 606 aa AA seqDB search
MNFKKWASILFAMMLLVSLLSAVGGPTTQAADNSVTLYYKKGFANPYIHYRQADGNWTAA
PGVKMADAEVSGYAKTTINIGSSSQLEAVFNNGTGTWDNNGSKNYFFKTGTSTYVPGANN
APGTITSGAPSDTITPTPDPTTPPPSDNFGPVDWSKRSIYFIMTDRFDNGDTSNDNYGGF
NSNKSQPIQWHGGDFQGIINRLDYIKNMGFTAIWITPVTMQKSVAAYHGYHTYDFYSVDG
HLGNMAKFQELVKTAHSKNIAVMLDVVVNHTGDFMPGNGTAKAPFDKTDWYHNAGEITQN
DYNSNNQSRIENGDVANLDDLKQENPAVATELKNWGKWIIQQSNVDGLRVDTAKHVPKWF
LKDFDTAVNTFTIGEVFHGDPVYVGDYSNYLDAVLDFPMYYTMRDVFAKDGSMNLIKERY
AQDSRYKNPNLNGTFLDNHDVKRFLNEATGKPGANSDKWPQLKAALGFLLTSRGIPIVYQ
GTEQGFNGGDDPANREDMKFDTNNELYKYIAKVNAIRNSHPALQNGSQKEKWVDNTFYAY
QRSSGTDEVVVLINNSWSNETRTIPNLDNFGNGTVLKNQMGTDSVTVNGGSINVTLGPKE
VKILTK
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcaaaaagtgggcatctattctatttgcgatgatgctgctggtatcgctgctg
tctgctgtcggtggtcctacgactcaagcggcagataattcggttaccctgtattacaaa
aaaggcttcgcgaatccgtacatacattaccgtcaggctgatggtaactggacggcagct
cccggcgtgaaaatggccgatgccgaggttagcggctatgcgaaaacaacaattaatatc
ggatcttcttcccagctagaagctgtattcaacaatggcactggcacatgggataacaac
ggatccaaaaactatttcttcaaaaccggtacttctacttatgtcccgggtgccaataat
gctccaggtactatcacttccggtgcaccaagcgacactataacaccaacaccggatcca
actactccgccaccatccgataattttggtccggtggactggagcaagcgcagcatctac
tttatcatgacggatcgctttgacaatggtgataccagcaatgataactatggtggcttc
aactccaataaaagccagccgatccagtggcatggcggcgacttccaggggattatcaac
cgcctggattacatcaaaaacatgggcttcaccgcgatctggatcactccagtaacgatg
caaaaaagcgtagctgcgtatcatggctatcatacgtatgacttctactctgtagatggt
catctcggtaatatggccaaattccaggagcttgtcaaaacggctcacagcaaaaatatc
gcagttatgctggatgtcgtggttaaccataccggcgatttcatgccgggcaacggtaca
gccaaagctccatttgacaaaacagactggtaccataatgccggtgagattacccagaat
gactacaactccaataaccaatcccgtatcgagaatggcgatgtcgctaacctcgacgat
ctgaagcaggaaaacccggcagttgcaaccgaactgaaaaactggggcaaatggattatc
caacaatccaatgtagatggcctgcgtgtcgatacagccaagcatgtaccaaaatggttc
ctgaaagactttgacacggctgtaaatacattcactatcggtgaagtattccatggtgac
cctgtctatgtcggtgactacagcaattatctggatgctgtactcgacttcccgatgtac
tacaccatgcgtgatgtatttgccaaagacggctccatgaacctgatcaaagaacgttat
gcccaggattcccgttacaaaaatcctaatctgaatggtacattcctggataaccatgat
gtgaaacgtttcctgaatgaagcaacaggcaaaccgggtgccaactccgataaatggcct
cagctgaaagctgctcttggtttcctgctgacttcccgtggtattccgattgtgtatcaa
ggtaccgaacagggcttcaacggcggtgacgatccagccaaccgtgaagacatgaagttc
gataccaacaatgagctgtacaaatatatcgccaaagtcaacgcgatccgtaacagtcat
ccggcgctgcaaaacggttcgcaaaaagaaaaatgggtggataacacgttctacgcgtac
caacgttccagcggtaccgatgaagtcgttgtcctgatcaacaactcctggagtaatgaa
acacgtacaattccgaacctcgataacttcggcaacggaacggtgctgaaaaaccaaatg
ggtactgattctgtaacagttaacggtggctcgatcaacgtaactctgggaccaaaagaa
gtaaaaatcctcacgaaataa

DBGET integrated database retrieval system