KEGG   Paenibacillus bovis: AR543_19745Help
Entry
AR543_19745       CDS       T04407                                 

Definition
(GenBank) single-stranded-DNA-specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
pbv  Paenibacillus bovis
Pathway
pbv03410  Base excision repair
pbv03430  Mismatch repair
pbv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pbv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    AR543_19745
   03430 Mismatch repair
    AR543_19745
   03440 Homologous recombination
    AR543_19745
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pbv03400]
    AR543_19745
Enzymes [BR:pbv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     AR543_19745
DNA repair and recombination proteins [BR:pbv03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     AR543_19745
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     AR543_19745
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AR543_19745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ssDNA-exonuc_C RecJ_OB DHHA1 DHH PRNT
Motif
Other DBs
NCBI-ProteinID: ANF98034
UniProt: A0A172ZK76
LinkDB All DBs
Position
complement(4680129..4682543)
Genome map
AA seq 804 aa AA seqDB search
MIHSQYHWNVHYPDPAEAQRLSAKLGISELTASLLAGRGYTGEMEAAEFLSGSRSTSHDP
YLLAGMKEAVERIRQALSAGEKIWIYGDYDADGVSSTSLMIQLMRHLNADYDIYIPHRSK
EGYGLHNHAIDQAHAQGVTLIVTVDTGISAVSQIAHAAALGIDVVVTDHHEPPAELPAAC
ALVNPKLEYCTYPFKGLAGVGVAYKLAQALLGKDQVPEEWLEIVSIGTVADLMPLEDENR
MMVRTGVERMKHSAFAGVRALMNIAAIDPAQMSATHIAFAMAPRINASGRMEHAKRAVEL
LTTTNQAEADQISFELDQLNKERQDLVNRMVQEAIIMLEAEKDMNNGSIPHVIVVAGEGW
NPGVVGIVASKLLDRYYRPTIVLGTDPQTGMSKGSARSIPGYDIYKALLDCEDVMDHFGG
HPSAAGMSLHRDQLNEFRRRLNERAAGMLTEEDLVPQTAADHECTLDQLTLSAIEELDQL
APFGMSNPLPRIVLRGVTVTQAKAIGKTLDHLRLVVEQDGTMMEGIAFGKGELAELLSEG
DRIDILAETSINEWRGNRKPQLMVQDLAVPGLQVWDRRSSGQWEQHLKTIRQKWSRYMGV
EGGQLGVLCSENRVETLKTQLSDVSLWGYDRKVDIAACNHVSTQYGAEAIRTLCLLSLPA
HIEQLDTIFEQFTSLENIVLLHDRPQQQERLQIPDRDRFKLIYGWLVKSSETIAEEAKLV
PYLSQKTSSSVRMVQMMLEVFEELEFIIRRDGQVMLNNAPVKRPLDSSQLYRELGELAEM
EYMLCESDLPQLTSWMISRMQGAS
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgattcattcacaatatcactggaatgtacattatcccgatccggctgaagcccagagg
ctcagtgcaaagctggggatctcggagctaacggcttcgctgctggctggcagaggatat
acgggagaaatggaagcggccgaattcctgtcgggcagccgcagtacatcgcatgatcct
tatctgctggccggtatgaaggaagcggtagagcggatacgccaggctttgtcggcaggc
gagaagatatggatctatggcgattatgatgctgacggtgtatccagtacatcactgatg
attcagttgatgcgtcatctgaacgccgattacgatatttatattccccatcgctccaaa
gagggctatggtctgcataaccatgcgattgatcaggcacatgcacagggagtgacgctg
attgttacggtcgacaccgggatcagtgcagtgtcccagattgcccatgctgcagcgctc
ggaatcgatgtggtcgtaaccgatcatcatgagccgccggcagagctgcctgctgcctgt
gcgctcgtgaatccgaagcttgaatactgcacgtatccttttaaaggattggctggtgta
ggtgtggcctacaagctggcacaggcactgctcggcaaggaccaggtaccggaagagtgg
ctggagatcgtctcgatcggtacagtggccgatttgatgccgctggaagatgagaaccgg
atgatggtgcgtacgggtgtagagcggatgaagcacagtgcatttgccggtgtacgcgca
ctgatgaatattgcagcgatcgatccggcgcagatgtcggcgacccatattgcttttgct
atggcaccgcgcattaatgccagtggacgcatggagcatgccaaacgcgcagtggagctg
ctcacgactaccaaccaggcagaagccgatcagatctcttttgaactggatcagctgaat
aaagaacggcaggatctggtaaaccggatggtacaggaggccattatcatgctggaagcc
gagaaagacatgaacaatggcagcattccgcatgtaattgtcgtagctggcgaaggctgg
aatcccggggttgtcggtatagtggcatccaaactgctagatcgttattaccggcctacg
attgtgctcggtaccgacccgcagacaggcatgagtaaaggctccgcacgttctatcccc
ggctatgatatctataaggcactgctggattgcgaggatgtgatggatcattttggcggt
catccatcggcagcaggtatgagtctgcaccgggatcagctgaacgaattccggcggcgg
ctgaatgaacgggcagcaggcatgctgaccgaagaagatctggttccccagacagcagcg
gatcatgaatgcacgctggatcaactcaccctgtctgcgatcgaggagctggatcagctg
gctccctttggcatgtccaatcctttgccgcgtattgttctgcgcggtgtgaccgtgacc
caggccaaagccatcggcaagacgctggatcatctgcggctcgttgtagagcaggatgga
accatgatggaaggcattgcttttggcaaaggcgaactggctgagctgctgtccgagggt
gaccggattgatatactggccgagaccagcattaacgaatggcgtggcaatcgcaagccg
cagctgatggtacaggatctggctgtgcctggacttcaggtctgggatcggcgcagttcc
ggtcagtgggagcagcatctgaagaccatccggcagaaatggtcgcgttatatgggcgtg
gaaggtggccagctgggtgtgctgtgcagcgaaaatcgggtggaaactttaaaaacccaa
ttgtcggatgtatccctttggggttatgatagaaaagttgatatcgcagcttgcaatcat
gtctccacacagtatggggcagaagctatacgcacattatgtctgttatcattaccggcg
catatcgagcagctggatactattttcgaacagttcacttctcttgaaaatatcgtcctg
cttcatgatcggccgcagcagcaggaacgtctgcagatacccgaccgggaccgttttaaa
ctgatatacgggtggcttgtcaaatccagcgagacgatcgcggaggaagcgaagctggtt
ccctatctaagtcaaaaaacctccagctcggtaagaatggtacagatgatgctggaagtg
ttcgaggaactggagtttattatccgtcgggatggacaggttatgctgaataacgctccg
gtaaaacgtccgctcgacagctcacagctgtaccgggaacttggcgaactggctgaaatg
gaatatatgttatgtgaaagtgatctgccgcaattaacttcatggatgatttcccgcatg
caaggcgcatcataa

DBGET integrated database retrieval system