KEGG   Paenibacillus bovis: AR543_21695Help
Entry
AR543_21695       CDS       T04407                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pbv  Paenibacillus bovis
Pathway
pbv00620  Pyruvate metabolism
pbv00680  Methane metabolism
pbv01100  Metabolic pathways
pbv01120  Microbial metabolism in diverse environments
pbv01200  Carbon metabolism
Module
pbv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AR543_21695
  09102 Energy metabolism
   00680 Methane metabolism
    AR543_21695
Enzymes [BR:pbv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AR543_21695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ANF98350
UniProt: A0A172ZMJ4
LinkDB All DBs
Position
complement(5105537..5108332)
Genome map
AA seq 931 aa AA seqDB search
MSELTVNVSKNHSNNLLRRDVRFLGNILGEVLVHQGGQELLDIVEKIRELSKSLRAVSLP
EVFEEFKTLIKNLDSDNRHQVIRAFAVYFQLVNIAEQNHRIRRKRDYERSAGENVQSGTM
ENAVQELKNNNFTAEEVEAIFADLSLELVMTAHPTEAMRRAILDIHKRISEDVKLLDNPT
LTFREREQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETLFDVLPELYQELE
RSLSKHYPEHDWHVPGFLRFGSWIGGDRDGNPSVTAEVTWKTLQMQRKLAIREYQRILRE
MMQSLSFSTTIIDVSEELLSSIQKDRLHVTIDKIYSWNNENEPYRIKIAYMLRKLSNIGD
DSKQGTTERYNDVSELLEDLKVIDKSLRHHYADYVADTYVKKMIRQVELFGFHTATLDVR
QHSQEHENSLKEILANMEIVEDYSKLQEEEKIELLGKLLSDPRPITSPYFKYSESTEECL
AVYRTIHKAQQEFGTNCISSYLISMTQGASDILEVMVFAKEMGLFRQLADGSVHCTLQAV
PLFETIDDLHEAPRIMRQVLDLPAYRKAVAAMNDLHEIMLGYSDSNKDGGVVTANWELRL
ALNNITAMGQEYSIKLKFFHGRGGALGRGGMSLDRSILAQPPHTIGGGIKITEQGEVLSS
RYSLQGIAYRSLEQAISALIHSATIAKTGEPAGEGNEEWEDIIRGISEVSLDKYQQLIFR
DPDFMSFFKQSTPLPEVGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRYLLPAWYAA
GTGLQHFYQNQPENMAVLQIMYKEFPFFTTLIDTLQMAIAKADLTIAREYAGMCQDDQSR
ARIFGLIESEFNLTRDLVLQITGQQDILDNVPVIQESVRLRNPYVDPLSYLQVQLLSELR
QIREEGADDPELLREVLLTINGIAAGLRNTG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagttgacagtcaatgtgagtaaaaatcattctaataatttgcttcgacgtgat
gtacgttttttgggcaatatcctgggagaggtactcgtacaccagggaggccaggagctg
ctggatatcgtcgaaaaaattcgtgagttgagcaaatcattacgggcagtttctttgcca
gaggtatttgaagaattcaaaacattaatcaaaaatctggattctgataacagacatcag
gttatacgtgcttttgctgtttattttcaactcgttaatatcgcagagcaaaatcatcgt
atccgccggaaacgtgattatgaacgttctgctggtgaaaatgtacaatctggaacgatg
gaaaacgctgttcaggaactgaaaaataataactttacggctgaagaggttgaagcgatc
tttgctgacctttcactggaactggttatgactgcccatccaaccgaggctatgcgccgg
gctattctggatattcataagcgtatttctgaagatgtaaagctgctggacaatccaacg
cttactttccgtgaacgggaacaactgcgtgagaagctgctgaatgaggttattactctc
tggcaaacagacgagctgcgtgatcgcaaaccgactgtactggatgaagtgcgtaacggg
atgtattacttccacgagacgctgtttgatgtactacctgaattgtatcaggagctggag
cgttcgctgtccaaacattaccctgagcatgactggcatgtacctggtttcttgcgcttt
ggctcatggattggtggagaccgggatggtaacccttctgttacagcagaagtgacctgg
aaaacactacagatgcagcggaagctggctattcgtgaataccagcgtatcctgcgtgaa
atgatgcagtcgctgagcttcagcacaacgatcattgatgtgtcggaagaactgttgtct
tctattcaaaaagatcgtctgcatgtcactatcgataaaatctacagttggaataatgaa
aatgagccttatcggatcaagatcgcttatatgctgcgcaagctgagcaatattggtgat
gattccaagcagggtactacagagcgttacaatgatgtatctgaactgctggaagatctg
aaagtgattgataagagccttcgtcatcattatgctgattatgtagcggatacatacgtg
aaaaagatgatccgccaggttgagctattcgggttccatacggctacacttgacgtacgt
caacatagccaggagcacgagaactcccttaaggaaattctcgccaatatggagattgtg
gaggattactccaaacttcaggaagaagagaaaatcgagctgcttggcaagctgctaagc
gatccaagaccgattacttctccttatttcaaatatagcgagagcacagaagagtgtctg
gcagtgtatcgtacgattcataaagcgcagcaggagttcggtaccaactgtatctccagc
tacctgatcagtatgacacagggagcgagcgatattctggaagtgatggtattcgccaaa
gagatgggattgttccgtcaattggcggacggcagtgtacactgtacattgcaggcagtt
ccgctgttcgagacgatcgatgatctgcacgaagcacctcggattatgcgtcaagtgctt
gatttgcctgcttatcgcaaagcagtagcagcgatgaatgacctgcatgagattatgctt
ggttactcggatagcaacaaagatggcggtgtggttacagcaaactgggaactgcgtctt
gcccttaacaatattacggcgatgggccaggaatacagcatcaagctgaaatttttccat
ggtcgtggtggtgcgctcggtcgcggcggaatgtcgctggatcgcagtattcttgcacag
ccgccgcatacgatcggtggaggcatcaagattacggagcagggtgaagtattatcatcc
cgttactctttgcagggaattgcttaccgtagtctggaacaggcaatctctgcgctgatt
cattccgctacgattgccaaaaccggagaacctgccggtgagggaaatgaggagtgggaa
gacatcattcgtggtatttcggaagtatcgctggataaataccagcagctgattttccgt
gatcctgactttatgagcttcttcaagcagtccacgcctttgccggaagtaggcgaactg
aatatcggttctcgtccttccaaacgtaaaaacagtgatcggttcgaggatttacgggca
attccgtgggtatttgcctggacacagagtcgttatctgctaccggcatggtatgctgcc
ggtacaggattgcagcatttttatcagaatcagcctgaaaatatggctgttctgcaaata
atgtataaagagttcccgttctttacgacattgatcgatacgctgcaaatggctattgcg
aaagcggatctgacgattgccagagagtatgcaggaatgtgtcaggatgatcagtcccgc
gcacgcatcttcggattaatcgagtccgaatttaatctgactcgtgatctggtacttcaa
attaccggacaacaggacattcttgataatgttccggttattcaggaatcggtacgtctg
cgtaacccatatgtagatccactcagctatttgcaggtacagctgcttagtgaactgcgc
cagattcgtgaagaaggtgcagatgatccggaattgctgcgtgaagtactattgacgatc
aatggtattgcggcaggtttgagaaatacgggctga

DBGET integrated database retrieval system