KEGG   Paenibacillus bovis: AR543_21960Help
Entry
AR543_21960       CDS       T04407                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pbv  Paenibacillus bovis
Brite
KEGG Orthology (KO) [BR:pbv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pbv03012]
    AR543_21960
   03029 Mitochondrial biogenesis [BR:pbv03029]
    AR543_21960
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbv04147]
    AR543_21960
Translation factors [BR:pbv03012]
 Eukaryotic Type
  Elongation factors
   AR543_21960
 Prokaryotic Type
   AR543_21960
Mitochondrial biogenesis [BR:pbv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AR543_21960
Exosome [BR:pbv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AR543_21960
  Exosomal proteins of breast cancer cells
   AR543_21960
  Exosomal proteins of colorectal cancer cells
   AR543_21960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ANF98387
UniProt: A0A172ZMC7
LinkDB All DBs
Position
complement(5137909..5139099)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITTVLSKTYGGAAVAFDQIDKAPEERERG
ITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVEDEELLELVEMEVRDLLSEYDFPGDDTPITRGSAREALA
NPDGDWAKKIVEMFETIDTYIPTPERDTDRPFLMPVEDVFSITGRGTVATGRIERGTVKV
GDEIEIVGIQEETKKSVVTGVEMFRKLMDSAQAGDNIGALLRGVDRTQIERGQVLSKPGS
VNPHTEFSAQVYVLTKEEGGRHKPFFTGYRPQFYFRTTDVTGVISLPEGTEMVMPGDNIT
VSVSLINPIAIEEGTRFAIREGGRTVGAGAVATISK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaaatttgaacgtaataaaccgcacgttaacatcggtactatcggtcac
gtcgatcatggtaaaacaactctgactgctgcaatcacaactgtactgtccaaaacttac
ggtggtgctgctgtagcattcgatcaaatcgataaagctccagaagagcgcgagcgcggt
atcactatctctactgcacacgttgagtacgaaactcctaaccgtcactatgcacacgtt
gactgcccaggtcacgctgactatgttaaaaacatgatcactggtgctgcacaaatggac
ggagcgatcctggttgtatccgcagctgatggccctatgccacagactcgtgagcacatc
ctgctgtcccgccaagtaggcgtaccttacatcgtagtattcctgaacaaatgtgacatg
gtagaagacgaagagcttctggaactggtagaaatggaagttcgcgatctgctgagcgaa
tacgatttcccaggcgacgatactccaatcactcgtggttctgctcgtgaagcactggct
aaccctgatggcgactgggctaagaaaatcgttgaaatgttcgaaacaatcgatacttac
atcccaactccagagcgcgacactgatcgtccgttcctgatgcctgtcgaggacgtattc
tctatcactggtcgtggtacagttgcaactggccgtatcgagcgtggtactgttaaagtc
ggcgacgagatcgaaatcgttggtatccaagaagaaactaagaaatccgttgttacgggc
gtagaaatgttccgtaaactgatggattccgctcaagctggtgacaacattggcgccctg
ctgcgtggtgttgatcgtactcaaatcgagcgtggacaagtactgtccaaaccaggttct
gttaacccgcatactgagttttccgctcaagtatacgttctgacaaaagaagaaggtggc
cgtcacaagcctttcttcactggttaccgtccacagttctacttccgtacaactgacgta
actggcgttatctccctgccagaaggtactgaaatggttatgcctggtgataacatcact
gttagcgtatccctgatcaacccaatcgcgattgaagaaggtactcgctttgcgatccgt
gaaggcggacgtacagtaggcgctggcgcggttgctacaatctccaaataa

DBGET integrated database retrieval system