KEGG   Pseudoalteromonas sp. Bsw20308: D172_003135Help
Entry
D172_003135       CDS       T04175                                 

Definition
(GenBank) thiamine biosynthesis protein
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
pbw  Pseudoalteromonas sp. Bsw20308
Pathway
pbw00730  Thiamine metabolism
pbw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    D172_003135
Enzymes [BR:pbw01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     D172_003135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO TrkA_N Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ALQ07142
LinkDB All DBs
Position
730981..731982
Genome map
AA seq 333 aa AA seqDB search
MFYNIAVVGFGLAGRLAALELSKLHHVTVFEADDEQTPNSAGKVAAAMLAPLAESVLCEA
DLALMGLDSMKRWPGIIAELESDVFFQQQGTLVVAHQQDKGDLQSFTQRIKPVAGHSAQA
LNAQQITRLEPELANRFNQGLFLPCEGQIDNQAFYKASFTMLNKRKVKCVFNQRVTIKNG
EINNRPFDYIIDCRGLGAKSDKPLRGVRGEVARLYAPEVNLTRPVRLMHPRYPIYIAPKP
NHEYVIGATEIESQDSGAATVRSTLELLSAAYTVHSGFAEARLLNIQAGLRPAFSDNRPE
VSQVGNVISINGLYRHGYMLAPALVAQVVSRIE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgttttataacattgcagtggtgggttttggtttagcagggcgcttagctgcccttgag
ctaagtaagttgcatcatgtaacggtgtttgaagcagacgacgagcaaaccccaaatagc
gccggtaaagtggcagcagcaatgcttgccccgcttgctgagtcggtattgtgtgaggct
gatttagctttaatggggcttgattcaatgaaacgctggccgggcattattgcagaactt
gaaagtgacgttttttttcagcagcaaggcacattggtcgttgcgcatcagcaagataaa
ggcgatttacaaagctttacccagagaataaagcctgtagcagggcacagcgctcaggca
ttgaatgctcagcaaataacgcggttagagccagagcttgctaatcggtttaaccaaggt
ctatttttaccctgcgaggggcaaatagataaccaagccttttataaagcaagttttacc
atgctcaacaagcgcaaagttaagtgtgtgtttaaccagcgcgtaaccattaaaaacggt
gaaataaataatcgaccatttgactatattatagattgtcgtgggcttggtgctaaaagc
gataaaccgcttagaggtgtgcgcggtgaagtcgcaaggctatatgcacctgaagtaaat
ttaacgcgacctgtgcgtttaatgcatccgcgttacccaatttatatagcgcctaaacct
aatcatgaatatgtaattggtgcgaccgaaatagaatcgcaagatagcggcgccgcaaca
gtgcgatcaactcttgagttactttcagcggcttataccgtacacagcggatttgccgaa
gcacgactacttaatattcaagccggattacgccctgcatttagcgataaccgcccagaa
gtatcacaagttggcaatgtaattagcattaacggcttatatcgtcatggttatatgctg
gctccggcattagtggcgcaagtagtttcacgaatagagtga

DBGET integrated database retrieval system