KEGG   Pseudoalteromonas sp. Bsw20308: D172_008845Help
Entry
D172_008845       CDS       T04175                                 

Definition
(GenBank) beta-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
pbw  Pseudoalteromonas sp. Bsw20308
Pathway
pbw00061  Fatty acid biosynthesis
pbw01100  Metabolic pathways
pbw01212  Fatty acid metabolism
Module
pbw_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pbw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    D172_008845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pbw01004]
    D172_008845
Enzymes [BR:pbw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     D172_008845
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     D172_008845
Lipid biosynthesis proteins [BR:pbw01004]
 Fatty acid synthase
  Component type
   D172_008845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA DUF5608
Motif
Other DBs
NCBI-ProteinID: ALQ08156
LinkDB All DBs
Position
2060007..2060522
Genome map
AA seq 171 aa AA seqDB search
MEPKNSYTKEELILCGQGEMFGEGNCRLPSDNMLMMDRITSITADGGIHGKGEIVAELDI
DPSLWFFDCHFKGDPVMPGCLGLDAMWQLVGFYLGWSGGPGLGRALGVGEVKFTGQILPT
NKKVTYRLVMKRVIKRKLFMGVADGTVEVDGRVIYEAKDLKVGLFQDTSAF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggaacctaaaaatagctatacaaaagaagagttgatcctgtgtggtcaaggtgaaatg
tttggtgaaggcaactgccgtttgccaagtgacaacatgttaatgatggatcgcattacc
tctattactgctgatggcggtattcatgggaaaggcgaaattgttgctgagcttgatatt
gaccctagcctttggtttttcgattgtcattttaaaggcgacccagtaatgcctggttgt
ttaggcttagatgctatgtggcaactagttggtttttacttaggttggtctggtggccct
ggtcttggccgtgcgctaggtgtgggtgaagttaaatttactggccaaattttaccaact
aataaaaaagtaacttaccgccttgtaatgaaacgcgtaattaaacgtaaattgttcatg
ggcgttgcagatggcactgtagaagtagatggccgagtaatttacgaagcaaaagattta
aaagtgggcttgttccaagacactagcgcgttttaa

DBGET integrated database retrieval system