KEGG   Pseudoalteromonas sp. Bsw20308: D172_009230Help
Entry
D172_009230       CDS       T04175                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
Organism
pbw  Pseudoalteromonas sp. Bsw20308
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C Pyr_redox_2 AdoHcyase_NAD XdhC_C F420_oxidored HI0933_like Pyr_redox 3HCDH_N NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ALQ08224
LinkDB All DBs
Position
complement(2142973..2143995)
Genome map
AA seq 340 aa AA seqDB search
MQAAQYIGNKSFNIVEGTSIKPKAGEIRLSVGYVGICGTDMHIYHGVMDQRVSIPQTIGH
EISGVVAEIGEGVEGFAVGENVVVRPLDWCGDCPTCNAGHTHICQNLKFMGIDTPGAFQS
SWTVKARTLHKLPAGVDLKQGALIEPLSVACHDVRRSRLQAGEKVVVLGGGPIGQLVAAV
AKSVGAEVLVSEPNESRRAFADELGVKSVNPIEEDLATYVDSWTQTKGADVVFEVSGVKP
AIEAMTEIAGRRGRIVMVAIHSVKPEIDLFQFFWKELELLGARVYEAADFDWAIELISSG
QIDLKPFISSVSSLTDIGSAFASMDGNPEGMKALVECNPQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctgcacaatatataggtaacaagtcatttaacattgttgaaggcacatctatt
aaacctaaagcgggtgagattagattgagtgttggatacgttgggatttgtggtactgat
atgcacatataccatggtgtgatggatcaacgagtgtctattccgcaaacaattggccat
gaaatatcaggtgttgttgcagaaataggtgaaggcgttgaaggctttgctgtcggcgaa
aacgtggtagtacgtccactagattggtgtggcgattgtcctacgtgtaatgcagggcat
acgcatatttgtcaaaacttaaagtttatgggaatagatacgccaggtgcttttcagtca
agctggacagttaaagcgcgtactttgcataaattaccagcaggcgttgatttaaaacaa
ggcgcattaatagagccgttatcggttgcgtgccatgatgtacgacgctcgcgcttacaa
gcgggtgagaaagttgttgtgcttggtggcgggccaattgggcaattagttgctgcggtt
gctaaaagtgttggcgcagaagtactcgtgtctgagcctaacgaaagccgccgtgctttt
gccgatgagctaggtgttaaatcggttaatcccattgaagaagatttagctacctatgta
gatagctggacgcaaacaaaaggtgctgatgttgtatttgaagtatcaggcgtaaaaccc
gcaatagaggctatgactgaaatagcagggcgccggggtcgtatagtcatggtggctatt
cacagtgttaaacctgaaatcgatttatttcaatttttttggaaagagttggagttatta
ggtgcacgtgtatacgaagcggccgactttgattgggctatcgaattaatttcatcgggc
caaatagatcttaaaccttttattagttcggttagttcgttaactgatattggtagtgca
tttgcgagtatggatggaaatccagaaggcatgaaagcgcttgttgaatgtaacccacaa
taa

DBGET integrated database retrieval system