KEGG   Pseudoalteromonas sp. Bsw20308: D172_009230
Entry
D172_009230       CDS       T04175                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pbw  Pseudoalteromonas sp. Bsw20308
Pathway
pbw00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pbw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    D172_009230
Enzymes [BR:pbw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     D172_009230
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     D172_009230
    1.1.1.-  
     D172_009230
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Pyr_redox_2 AdoHcyase_NAD XdhC_C HI0933_like Pyr_redox 3HCDH_N NAD_binding_7
Other DBs
NCBI-ProteinID: ALQ08224
LinkDB
Position
complement(2142973..2143995)
AA seq 340 aa
MQAAQYIGNKSFNIVEGTSIKPKAGEIRLSVGYVGICGTDMHIYHGVMDQRVSIPQTIGH
EISGVVAEIGEGVEGFAVGENVVVRPLDWCGDCPTCNAGHTHICQNLKFMGIDTPGAFQS
SWTVKARTLHKLPAGVDLKQGALIEPLSVACHDVRRSRLQAGEKVVVLGGGPIGQLVAAV
AKSVGAEVLVSEPNESRRAFADELGVKSVNPIEEDLATYVDSWTQTKGADVVFEVSGVKP
AIEAMTEIAGRRGRIVMVAIHSVKPEIDLFQFFWKELELLGARVYEAADFDWAIELISSG
QIDLKPFISSVSSLTDIGSAFASMDGNPEGMKALVECNPQ
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcaagctgcacaatatataggtaacaagtcatttaacattgttgaaggcacatctatt
aaacctaaagcgggtgagattagattgagtgttggatacgttgggatttgtggtactgat
atgcacatataccatggtgtgatggatcaacgagtgtctattccgcaaacaattggccat
gaaatatcaggtgttgttgcagaaataggtgaaggcgttgaaggctttgctgtcggcgaa
aacgtggtagtacgtccactagattggtgtggcgattgtcctacgtgtaatgcagggcat
acgcatatttgtcaaaacttaaagtttatgggaatagatacgccaggtgcttttcagtca
agctggacagttaaagcgcgtactttgcataaattaccagcaggcgttgatttaaaacaa
ggcgcattaatagagccgttatcggttgcgtgccatgatgtacgacgctcgcgcttacaa
gcgggtgagaaagttgttgtgcttggtggcgggccaattgggcaattagttgctgcggtt
gctaaaagtgttggcgcagaagtactcgtgtctgagcctaacgaaagccgccgtgctttt
gccgatgagctaggtgttaaatcggttaatcccattgaagaagatttagctacctatgta
gatagctggacgcaaacaaaaggtgctgatgttgtatttgaagtatcaggcgtaaaaccc
gcaatagaggctatgactgaaatagcagggcgccggggtcgtatagtcatggtggctatt
cacagtgttaaacctgaaatcgatttatttcaatttttttggaaagagttggagttatta
ggtgcacgtgtatacgaagcggccgactttgattgggctatcgaattaatttcatcgggc
caaatagatcttaaaccttttattagttcggttagttcgttaactgatattggtagtgca
tttgcgagtatggatggaaatccagaaggcatgaaagcgcttgttgaatgtaacccacaa
taa

DBGET integrated database retrieval system