KEGG   Pseudoalteromonas sp. Bsw20308: D172_009825Help
Entry
D172_009825       CDS       T04175                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pbw  Pseudoalteromonas sp. Bsw20308
Pathway
pbw00500  Starch and sucrose metabolism
pbw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    D172_009825
Enzymes [BR:pbw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     D172_009825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Asp_protease
Motif
Other DBs
NCBI-ProteinID: ALQ08326
LinkDB All DBs
Position
complement(2293237..2295645)
Genome map
AA seq 802 aa AA seqDB search
MKNYNLITISLLALGLTACGAQNTNQSQTAQTSKTTAPGAPGNDPFWSYAGKTGIGTSYE
QYQNGHYTSDAPTGVVSKVWFSIAKGMITETMFGLIHQAQIKDMQFVVTGKDFTVSEADD
LDVTIDYLYKDEQGRPLSLAYKIVSKDKQGRFTLEKHVFTDPDGQSLFVRSVFNTDLKDV
KAYVVVNPYIDNNGLDDFAKTTEQGLVAWQGDNYLTLQANTEFGAKTVGFTGVSDGLDEL
KKSQALNTSYSNTGEQSGNVSLLAELGNIESNTTFDLVLSFAHNEQQSAEQGAQTLAKGY
QSVLDNYNGKGAAFGWQDYLQSLTPINKMTGQTADNGKLLYTSAMVLKAQEDKTHAGALI
ASLSNPWGETVSAKTGSTGYKAVWVRDFYQVAMAFMALGDTATAKIAFEYLEKVQVNSKT
PGNNGDTGWFLQKTHVDGELEWVGVQLDQTAMPIMLAWKLHQANVLSDAELKDWYARMLK
PAADFLVEGGLAKILWNDTQITPPATQQERWEEQSGYSPSTTAAIVAGLVTASDIAALSG
DDKNAQRYLATAKKYNNDIESQMFTTEGNLKSENSDGEYFIRIGQDTDANSNTKINANNG
REGFNKKQILDGGFLELVRYGVRGANDESIVKTLPEYDDETLEDNLQVKYSFSFDDGSGT
FAGYRRYGNDGYGEDEVTGTNYAEGGSNTPGQRGRVWPFFTGERGHYEIAAANANNALDD
AKQAQIKNSYVKGLEQFANEGMMLPEQVWDGVGVNKAGYTLGEGTNSATPLAWTHAEYIK
LVRSLSDKQVWDHYPVVKKALK
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactataacctaattactatttcattattagcacttggattaactgcatgcggt
gctcaaaatacgaatcagtcacaaacagcacaaacatctaaaacaactgcgcctggtgct
ccgggcaacgacccgttttggtcatacgcaggtaaaacagggattggcacatcgtacgag
caataccaaaatggtcattacacaagtgatgcaccaacaggggtagtatcaaaagtctgg
ttttcaatagctaaaggcatgatcaccgaaactatgtttggccttattcatcaagcacaa
ataaaagatatgcaatttgtggtaacaggaaaagactttactgttagcgaagcagacgat
cttgatgtcactattgattatctatacaaagacgagcaaggccgtccgttatcacttgct
tataaaatagtaagtaaagataaacaaggcagattcactcttgaaaaacacgtttttacc
gatcctgatgggcaaagtttatttgttcgtagcgtgtttaataccgaccttaaagacgtt
aaagcctatgttgtggtaaatccatatattgataataacggccttgatgattttgcaaaa
actaccgagcaaggtttagttgcttggcaaggtgacaactacttaacattgcaagcaaat
actgaatttggcgcaaaaacggttggctttacgggtgtaagcgatggtttggatgagctt
aaaaagtcacaagcattaaataccagctatagcaatactggtgagcagtcaggtaatgtc
agtttacttgctgagcttggcaatattgaaagtaataccacgtttgatttagtactgagc
tttgcacataacgagcaacaaagtgcagagcagggcgcccaaacattagcaaaaggttat
caaagtgtacttgataactacaatggtaaaggtgcggcatttggttggcaagattaccta
caaagccttacacctattaataaaatgacggggcaaacggccgataacggtaagttactt
tataccagcgcaatggtattaaaagcacaagaagacaaaacgcacgcaggtgcgcttatt
gcgtcgttgtctaatccgtggggcgaaaccgtatcggctaaaacaggctcaactggttat
aaagccgtgtgggtacgagatttctaccaagtagctatggcatttatggcactgggtgat
acagctacagcaaaaatagcattcgaataccttgaaaaagttcaagttaatagcaaaacg
ccaggtaacaatggcgatacaggctggtttttacaaaaaacacatgtcgatggcgaacta
gaatgggtgggtgtacagcttgatcaaactgcgatgccaattatgcttgcgtggaaatta
caccaagcaaatgtacttagtgatgccgagcttaaagactggtacgcacgtatgttaaaa
ccagcggcggattttttagtcgagggcggccttgctaaaattttgtggaacgacacgcaa
attacaccaccggcaacacaacaagagcgctgggaagagcaaagcggttattcgccttca
actacagccgcaatagtagcaggccttgttacagccagtgatatagcagcgcttagtggc
gatgataaaaacgcacagcgctacctagctacggctaaaaagtataacaacgatattgaa
tcgcaaatgtttaccaccgagggtaacttaaaaagcgagaatagcgatggcgaatacttt
atccgtataggccaagataccgatgcaaactcaaacactaagattaacgcaaacaacggg
cgagaaggctttaataaaaaacagattttagatggcggcttcttagaactagtacgctat
ggcgtacgtggtgctaacgacgaaagcattgttaaaacattgcctgagtacgatgacgaa
acgcttgaagataacctacaagttaaatacagctttagctttgacgacggcagcggcaca
tttgcaggctaccgtcgctacggtaatgatggctacggcgaagatgaagtaaccggtact
aattacgcagagggtggcagtaatacaccaggccaacgtggtcgtgtatggccgtttttc
accggtgagcgtggtcactatgaaatagctgcagctaatgcgaacaacgctctggatgat
gctaaacaagcgcaaattaaaaacagctatgttaaaggcttagagcaatttgccaatgaa
ggcatgatgttaccagagcaagtatgggacggcgttggtgtaaacaaagcaggttataca
ctgggcgaagggactaattcagcaacacctctagcttggacacacgcagaatacattaag
ctggtacgctcactcagtgataaacaagtatgggatcactacccagttgttaaaaaagca
ctaaaatag

DBGET integrated database retrieval system