KEGG   Pseudoalteromonas sp. Bsw20308: D172_012170Help
Entry
D172_012170       CDS       T04175                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
pbw  Pseudoalteromonas sp. Bsw20308
Pathway
pbw00550  Peptidoglycan biosynthesis
pbw01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pbw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D172_012170
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    D172_012170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pbw01011]
    D172_012170
Enzymes [BR:pbw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     D172_012170
Peptidoglycan biosynthesis and degradation proteins [BR:pbw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   D172_012170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ALQ08736
LinkDB All DBs
Position
2778668..2780545
Genome map
AA seq 625 aa AA seqDB search
MLKHRPTIRDHSAEANLFARRAFVGFVFVLAMVAILLSNLYKIQVENHQDYQTRSNDNRI
KVIPIAPNRGLIYDRNGVLLAENKPVYNLEVIPEDVNDLTESLDQVSKIITISEQEKDDF
LKDIKHTRRFKSQILKARLNETEVAKFSVNQHKFPGFSIEARLARYYPFGDTLTHALGYV
AKLNKKELNKLDQEGQATNYRATYDIGKLGIEKYYEQLLHGEVGSQRVEVNNRGRVIRTL
SMIQPKPGSDIVLTLDIGLQQIAQHALKDMRGAIVVMDAKDGGVLALYSNPSYEPNLFVH
GISSKNYKALLNQDRPLINRATQGRYAPASTVKPHMAILALEENIVSESTSIWDPGFFEI
PNVEHKWRDWKRWGHGHVDVYKAIEESCDTYFYDAAYRLGITKISDFMARFGFGDLSGID
IHEETTAILPSKEWKEGRFKESWWRGDTISVGIGQGYWTATPIQIANATNILVNKGINHP
PHLAQVAKKEDQVTQINGDEKPPVILKNPDNWRIAIDAMHNTVKKVTGTAHKAFKGVSYD
PAGKTGTAQVVSIAQGERYDAKSLKERQRDNAIYVGFAPYNNPQIVLSIVVENTGGGSSV
GAPIARQLMDYYFAANPVELAGNIK
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaacatagacccactattcgtgaccactccgcagaagcaaatttatttgctagg
cgagcatttgtgggttttgtttttgtattagctatggtggctattttgctgtcaaatcta
tataaaattcaagtagagaaccaccaagattaccaaacccgctctaatgacaaccgtatt
aaagttattcctattgcacccaaccgtggtttaatttacgaccgtaacggtgtactcctt
gctgaaaacaaaccagtttacaatcttgaagtcattcccgaagatgtaaacgatttaacc
gaatcgctcgatcaagtcagtaaaataattactattagtgagcaagagaaagacgatttt
ttaaaagatattaaacacactcggcgtttcaaatcgcaaattcttaaagcacgcttaaac
gaaactgaagtcgctaagttttctgtaaatcaacataaattcccaggctttagtattgaa
gcacgcctagcccgctactacccctttggcgataccctaacccatgcactcggttatgtg
gcaaagcttaataaaaaagaacttaataaactagatcaagaaggtcaagcaaccaattat
cgagccacatacgatattggaaaattaggcatagaaaaatattatgaacaattattacac
ggtgaagtaggctcccagcgcgtagaagtaaataatcgcggccgcgttattcgcacactc
agtatgatccaacctaagcctggtagtgatattgtacttacgcttgatattgggctacag
caaatagcacaacatgcgcttaaggatatgcgcggcgctatcgtcgttatggatgcaaaa
gatggtggcgtactcgcactttattcaaatccaagctacgaaccaaatttattcgtacat
ggtataagtagcaaaaactacaaagcattgcttaaccaagatcgcccgctaattaaccga
gcaacacaaggtcgttacgcgccagcttcgactgttaaacctcacatggcaattttagcc
cttgaagaaaatattgtaagtgaaagcacttctatttgggatcctggcttttttgaaata
ccaaatgtggaacataaatggcgcgattggaaacgctggggtcatggccatgttgatgta
tataaagcgattgaagagtcgtgcgatacttatttttatgatgcagcttatcgcttaggt
attactaaaataagcgattttatggcgcgatttggctttggtgatttatccggtattgat
attcatgaagaaaccactgcaattttaccttcaaaagaatggaaagaaggccgctttaaa
gaatcatggtggcgaggtgatactatttctgtaggtattggacaaggctattggacggca
accccgattcaaattgctaacgcaacgaatattcttgttaataaagggattaatcatcca
ccgcatttagcccaagttgcaaaaaaagaagatcaagtaacgcaaattaacggtgatgaa
aaaccgccggtaatacttaaaaaccctgataactggcgcattgcaattgatgcaatgcat
aacacggtaaaaaaagtaacaggtaccgcacacaaagcttttaaaggtgtaagctacgat
ccggcgggtaaaacaggtactgcgcaagtagttagcattgcccaaggcgaacgttacgac
gctaaatcattaaaagagcgtcagcgtgataatgccatttatgttggttttgcaccttat
aacaacccacaaattgtgctctctatcgttgtagaaaacactgggggcggaagctcggta
ggtgcgccaattgctcgtcaattaatggactactattttgcagctaatcctgttgaactt
gcagggaatataaaataa

DBGET integrated database retrieval system