KEGG   Pseudoalteromonas sp. Bsw20308: D172_012185Help
Entry
D172_012185       CDS       T04175                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
pbw  Pseudoalteromonas sp. Bsw20308
Pathway
pbw00550  Peptidoglycan biosynthesis
pbw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D172_012185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pbw01002]
    D172_012185
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pbw01011]
    D172_012185
Enzymes [BR:pbw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     D172_012185
Peptidases [BR:pbw01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   D172_012185
Peptidoglycan biosynthesis and degradation proteins [BR:pbw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   D172_012185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 HTH_57
Motif
Other DBs
NCBI-ProteinID: ALQ08739
LinkDB All DBs
Position
2782726..2783886
Genome map
AA seq 386 aa AA seqDB search
MKSIKHKILKGVCGLVCTAAVFSASAQIIPAPPQVNAKGYFLVDFTTGKVIAQGEADTQL
APASLTKMMTSYVIGTEIKAGNIAPTDMVTVSEKAWAKNFPESSKMFIEVGKQISVDQLN
HGIIIQSGNDACVAMAEHIAGSESAFADLMNAHATKLGMSNSHFINSHGLDTNEHYTTPR
DMATLGAALIRDVPDEYALYKQKSFTYNGIKQYNRNSLLWDESLDVDGIKTGHTSEAGYS
LVTSATKNGMRLIAVVMGTSSERARKVENKKLLNYGFRFYETITPYKAGDSFAEQRIWMG
NKENVSLGILEDTPITIPRGQHKNLKANFELDNTLEAPLAKGTKVGTLFLQLEGEDIAQY
PLVTLEEVEEGSFFSKIYDYLRLQIM
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctattaaacataaaatcctcaaaggtgtatgcggcttagtttgtacagccgcc
gtattttcagccagcgcccaaattatcccggcaccacctcaagttaatgcaaaaggttat
tttttagtagactttacaacaggtaaagtaattgcccaaggtgaagctgatacgcagcta
gccccagcaagcttaactaagatgatgaccagttatgtaattggtactgaaattaaagcc
ggcaatattgcaccaacagatatggtaactgtgagtgaaaaagcatgggctaaaaacttc
ccagaatcgtctaagatgtttattgaagtaggtaagcaaattagtgttgatcagcttaat
cacggcattattattcaatctggtaatgatgcctgtgttgcaatggctgaacatattgct
ggaagtgaaagcgcatttgctgatttaatgaatgcacatgctactaaattaggtatgagt
aacagccattttatcaatagccacggccttgatacgaatgagcattatactactccacgc
gatatggcaaccttaggcgcagcacttattcgtgacgtaccggatgaatacgcactttat
aaacaaaagtcgtttacttataacggtattaagcaatataaccgtaactcgctattatgg
gatgaaagcttagacgtagacggtataaaaacaggccacacctcggaagctggctacagt
ttagtcacttcagcaactaaaaatggtatgcgtttaattgccgttgtaatgggcacttca
agcgaacgtgctcgtaaagtggaaaataaaaaactacttaactacggttttcgtttctat
gaaacaattaccccgtacaaggccggcgatagctttgctgagcaacgtatttggatgggt
aacaaagaaaatgtatctttaggtattttagaagatacaccaattactattccacgtggt
caacataaaaaccttaaagctaactttgagctagataacacgcttgaagcaccactcgct
aaaggcactaaagtaggtacgttattcttacaattagagggtgaagacattgctcaatac
ccactagtaacacttgaagaagtggaagaaggcagcttctttagtaagatttatgactac
ttacgtttacaaataatgtag

DBGET integrated database retrieval system