KEGG   Pseudoalteromonas sp. Bsw20308: D172_012715Help
Entry
D172_012715       CDS       T04175                                 

Definition
(GenBank) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
pbw  Pseudoalteromonas sp. Bsw20308
Pathway
pbw00270  Cysteine and methionine metabolism
pbw00450  Selenocompound metabolism
pbw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    D172_012715
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    D172_012715
Enzymes [BR:pbw01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     D172_012715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Aminotran_1_2 DegT_DnrJ_EryC1 GDC-P
Motif
Other DBs
NCBI-ProteinID: ALQ09801
LinkDB All DBs
Position
complement(2896629..2897810)
Genome map
AA seq 393 aa AA seqDB search
MSKHHINTQCIHGPQKANDPHGALTSPLYQTSTFHFENAAQGAARFAGDEPGYIYTRLGN
PTTTELEQKVAQLESSEAAAATATGMGAVSASVLSFLSQGDHLVASSALYGCTFAFFSHM
LPRWGIEVTFVDMTNEDELRAAIKPNSKMIFVETPINPTMAVIDLALIGAVAKEHNLISV
VDNTFLTPLLQSPKKYGIDIIMHSATKYLNGHGDVVAGIVCGSLEHITHIKMTVLKDIGA
TISPHDAWLINRGLKTLAIRIEHHCQSAQTIAQYLEAHPQVSTVYYPGLKSHPGYRFIGN
QMKAAGGVIAFEIKGTLQDGAQFIDSMKLCTLAVSLGDAETLIQHPASMTHSPYTPEERA
AAGISDGLIRLSVGLEDVNDIISDLDQAFTKIG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcatcatataaacacccagtgtattcacggaccacaaaaagcaaacgacccg
cacggcgcactcacttctcctttgtatcaaacctctacctttcattttgaaaatgccgca
caaggtgctgcgcgttttgcaggcgacgaacctggctatatttatacgcgcttaggaaac
cctacaaccacagagcttgaacaaaaagttgctcaactagagagcagtgaagcagcagct
gcaaccgcaacaggtatgggggctgtatctgcctcagtactgagctttttatcgcaagga
gatcatcttgttgcctcaagtgctttatatggttgtacctttgcgtttttctcgcatatg
ttgccgcgctggggaatcgaagtcacttttgttgatatgaccaacgaggacgagctacgc
gctgccatcaaacctaattcaaaaatgatatttgtagaaacgccaatcaaccccactatg
gcggttattgatttggcactcattggcgcagttgctaaagagcacaatttaattagtgtg
gtcgacaacacctttttaacgccgttactgcaatcacccaaaaaatacggcatcgatata
ataatgcacagtgcgaccaagtacttaaacggccacggagacgtagtcgccggtattgta
tgtggatcgcttgagcacataacacacattaaaatgaccgtattaaaagatattggtgca
accataagcccgcacgacgcatggctaattaatagaggtctaaaaacactcgctattaga
atagagcaccattgtcaaagcgcacaaacaatagcgcaatatctagaagcgcatccacaa
gtaagcaccgtatattacccggggcttaaatcgcacccaggttataggtttattggtaac
caaatgaaagccgctggtggtgttattgcgtttgaaataaaaggcacactacaagatggc
gcacaatttattgatagtatgaaactttgtacacttgcagtaagcctcggcgacgctgaa
acactaattcagcatcctgcatctatgactcattcgccttatacgccagaggagcgagct
gccgctggaataagtgatgggctgatcagactctcggttgggcttgaagatgttaacgac
attattagtgatttagaccaagcttttactaaaattggttag

DBGET integrated database retrieval system