KEGG   Pseudoalteromonas sp. Bsw20308: D172_013985Help
Entry
D172_013985       CDS       T04175                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pbw  Pseudoalteromonas sp. Bsw20308
Pathway
pbw00250  Alanine, aspartate and glutamate metabolism
pbw00410  beta-Alanine metabolism
pbw00430  Taurine and hypotaurine metabolism
pbw00650  Butanoate metabolism
pbw01100  Metabolic pathways
pbw01110  Biosynthesis of secondary metabolites
pbw01120  Microbial metabolism in diverse environments
pbw02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pbw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    D172_013985
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D172_013985
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D172_013985
   00430 Taurine and hypotaurine metabolism
    D172_013985
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    D172_013985
Enzymes [BR:pbw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     D172_013985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ALQ09065
LinkDB All DBs
Position
complement(3158840..3160465)
Genome map
AA seq 541 aa AA seqDB search
MDQKRCAVASKESLKRIFTVPEAPDSTLSKIELEISSNLAGFLNENIAAIEKPLHEIEKD
FQSAVIPEDPTFVSAYAQDIMEQLVAHSVHTAAPSFIGHMTSALPHFLLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLAYGQEDSFYSKWMHSAKTSLGAFCSGGTVANITAL
WIARNRLLKPDGDFRGIGAQGLIAGMLHYGYKGLAVLISERGHYSLGKSVDLLGIGRDNL
IGIKTCENNKVDVIAMREKARELEAQGIKVMAIIGVAGTTETGNIDPLDEMADLAQDINC
HFHVDAAWGGATLLSNTHRPLLKGIERADSITIDAHKQMYVPMGAGLVLFKDPAATDAIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLRVIGRKGYEMLIDRSIKKAHYFAGLI
KADEDFELISEPELCLLTYRYVPKQIKQAIKDADATTRLDIFASLNRFTASMQKRQRESG
RSFVSRTRLTPSKYDNQPTVVFRVVLANPLTSGAILKDILAEQKELAKTDPVFKKYLSKY
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaagcgttgtgccgtcgcctctaaagaaagccttaagcgtatatttactgta
cctgaagcgccagactcaactttaagcaaaatcgagcttgaaatttcgagtaatttagca
ggtttcttaaacgaaaatattgcggcaattgaaaaaccattacatgaaatagaaaaagac
tttcaatcggcagtgatcccagaagatccaacgtttgtatctgcttatgcccaagacatt
atggagcaacttgttgcgcattctgtgcatacagctgcgcctagctttattggtcacatg
acctctgctttgccgcattttttattaccgctgtcaaaactgatggtagggctaaatcaa
aatctagtaaaaatagaaacatctaaagcgtttacgcctcttgaacgtcaagtacttggg
atgatgcatcatctagcttatgggcaagaagattcattttattctaaatggatgcacagt
gctaaaacctcattaggtgcattttgctctggtggtacggttgctaatattactgcgctt
tggattgcgcgaaaccgtttattaaaaccggatggcgattttagaggtataggcgcacaa
ggcttaattgccggtatgctgcattatggctataaaggtttagcggtattaatatcagaa
cgtggacattattcattaggtaaatcggttgatttactcggcattggtcgcgataactta
attggtattaaaacctgcgaaaataataaagtcgatgtaatagcgatgcgcgaaaaagca
cgtgagcttgaagcgcaaggcattaaagtaatggccattattggggtcgcggggacaacc
gaaaccggtaatattgacccactggacgaaatggccgatttggcacaagatattaactgc
cattttcatgtagatgctgcatggggaggagcgacgcttttatcaaacacgcatcgtcct
ttattaaaaggaattgagcgagcagattcaattaccattgatgcacacaaacaaatgtat
gtacccatgggcgctggtttagttttatttaaagatcctgctgcaactgatgcaatagag
caccatgctgagtatatattacgtaaaggttcaaaagacttaggtagtcacacgcttgaa
ggtagtcgcccaggtatggcgatgttagtacatgcttgcttacgtgttattggtcgtaaa
ggctacgagatgttaatcgatcgtagtataaaaaaagcacattattttgctggtttaatt
aaagcagatgaagatttcgaacttatttcagagcctgagctgtgtttactaacgtatcgt
tatgtacctaaacagattaagcaggcaataaaagatgctgatgcaacaacacgtttagac
atttttgcatcacttaatcgttttactgcgagtatgcaaaagcgtcagcgggagtctggt
cgctcgtttgtatcacgtacacgcctaacgccatctaaatacgataatcaacctactgtt
gtatttagagtggtccttgcaaacccacttacatcaggcgctattttaaaagatatttta
gccgagcaaaaagaactagctaaaacagatcctgtatttaaaaagtacctcagtaagtat
atgtag

DBGET integrated database retrieval system