KEGG   Pseudoalteromonas sp. Bsw20308: D172_018530Help
Entry
D172_018530       CDS       T04175                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pbw  Pseudoalteromonas sp. Bsw20308
Brite
KEGG Orthology (KO) [BR:pbw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D172_018530
Enzymes [BR:pbw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D172_018530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored NAD_binding_8 FAD_binding_3 NAD_binding_9 AlaDh_PNT_C Thi4 K_oxygenase Glutaredoxin Lycopene_cycl Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: ALQ10080
LinkDB All DBs
Position
pPBSW1:288920..290500
Genome map
AA seq 526 aa AA seqDB search
MLDNNIKNQLKSHFESLTQPVELLIALDDSKKSAEVESLANDLASLSDKFTVINNPDTSA
RRPSMVVHSPIKNTHISFAGVPMGHEFTSLVLALLHTGGHASKAKSEDIEQIQSLTQELN
FEVYISLSCQTCPQVVQALNTMAATNSNIKATMIDGALFQDEVEERNILAVPAVYLNGEP
FSQGALSLTDILNKVDSKGAAKQAAALSEKDKFDVLVIGGGPAGASAAIYSARKGLNTGI
VADRFGGQVADTLAIENFISIKATEGPKLVAQLEEHVKEYDVDVMHNQRASALGYNNGYE
ITLENGAILKAKSLVLATGARWREMNVPGEQEYRGHGVAYCPHCDGPLFKGKPVAVIGGG
NSGIEAAIDLANIVQSVTVLEFADTLRADEVLIRKAKSMANITIIKSAQTTEVLGDGKKV
TGLMYTDRVTGESKELELAGIFVQIGLIPNTEWLKDSDLELSKFGEILIDAKGATSLPGI
YGAGDATNTPFKQIIIAMGSGATASLGAFDYLIRHSDETEQDQSAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttagataacaacataaaaaatcaattaaaaagccatttcgaatcgcttactcaacct
gttgagctgcttattgccttggatgacagcaaaaaatcagcagaagtagaaagcttagca
aacgatttagcctcactaagcgataaatttacggtaataaacaatcctgatacaagcgct
cgtcgcccatcaatggttgtacattcacctattaaaaacactcatatttcgtttgcaggc
gtacctatgggtcacgaattcacaagtttagtgttagcacttttgcatactggcggacac
gcaagtaaagctaaaagcgaagacattgagcaaatacaatcgcttactcaagagctaaac
tttgaagtatacataagtttaagttgccaaacgtgcccgcaagtagtgcaagcacttaac
actatggctgcgacaaacagtaatattaaagccaccatgattgatggcgcattatttcaa
gatgaagtagaagagcgaaatattttagctgtaccggctgtatatttaaatggcgaacca
tttagccaaggtgcattaagccttactgacatactcaataaagtagatagcaaaggggct
gctaaacaagccgcagcgctaagcgaaaaagataaatttgatgtacttgtcatcggtggt
gggcctgcgggtgcatcggctgcaatttactcagcgcgaaaagggttaaatacaggcatt
gtggctgatagatttggtggacaagttgccgatacattagcaatagaaaactttatttcg
attaaggcgactgaagggccaaaattagttgctcagcttgaagagcacgttaaagaatac
gatgtagatgtaatgcacaatcagcgtgcatcggcacttggttataacaatggttacgaa
attacactagaaaatggcgcaatacttaaagctaaatcgctcgtacttgccactggcgca
cgctggcgcgaaatgaacgtaccaggtgagcaagaatatcgcggccacggtgtggcatat
tgcccgcattgcgacggccctttgtttaaaggcaaacctgttgctgtaattggcggtggt
aattcaggtatagaagcggcaatcgatttagctaatattgtgcaaagcgttacggtactt
gaatttgcagacacattacgagctgacgaagtgcttattcgtaaagctaaaagtatggca
aatattactattatcaaaagtgcacaaacaaccgaagtacttggtgatggtaaaaaagta
actggcttaatgtacacagatagagtgacaggggagagcaaagagcttgaacttgctggt
atatttgtacaaataggcttaataccaaataccgagtggttaaaagacagcgaccttgaa
ttaagtaaatttggtgaaatactgattgatgctaaaggcgcaacgtcattaccaggcatt
tatggcgcgggggatgcaaccaatactccgtttaagcaaattattattgcaatgggcagc
ggtgcaacagcaagtttaggtgcatttgattatttaattcgccacagcgatgaaactgag
caagatcaaagtgctgcgtag

DBGET integrated database retrieval system