KEGG   Pelobacter carbinolicus: Pcar_0628Help
Entry
Pcar_0628         CDS       T00285                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00440  Phosphonate and phosphinate metabolism
pca01100  Metabolic pathways
pca01120  Microbial metabolism in diverse environments
pca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Pcar_0628
Enzymes [BR:pca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Pcar_0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase DRTGG ICL
Motif
Other DBs
NCBI-ProteinID: ABA87887
UniProt: Q3A6X0
LinkDB All DBs
Position
complement(755312..756214)
Genome map
AA seq 300 aa AA seqDB search
MQKKTSQFKSLLHSPDVQFLMEAHNGLSAKIVEEAGFKGIWGSGLAISAALGVRDNNEAS
WTQVLDVVEFMSDASSIPIMLDADTGYGNFNNVRRLVRKLEQRGVGAVCIEDKLFPKNNS
LLDDARQPLEAIDVFAGKIKAAKDTQQDEDFCVIARIEAFIAKWGLGEALKRAEAYHKAG
ADALLIHSKLSTAEEILAFMNEWQDTCPIVVVPTKYYTTPTSVFQEAGISLVIWANQLLR
SSVAAMQKTAAIIHEQQSLLGVEKEITPVKEVFRLQNTDELKKAEERYLPPTRTPDPSGG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaaaaacgtcccagttcaaatctctgttgcattcgccggatgttcaattcctc
atggaagcccataacggcttaagcgccaagatcgtcgaagaggctggtttcaaaggcatc
tggggcagcggactggccatatcggctgccctaggggtgcgggacaacaacgaagccagc
tggacccaggtactggacgttgtcgagttcatgagcgatgcatccagcatcccgatcatg
ctggatgccgacaccggctatggcaatttcaacaatgtgcgcaggttggtgcgtaaactg
gaacagcgaggggtcggcgccgtctgcatcgaggacaagctgtttccgaaaaacaactcg
ttgctggacgacgcccgtcagccattggaagctatcgatgttttcgccggaaaaatcaag
gcagccaaagacacccagcaggatgaggatttttgcgtcatcgcaagaatcgaagccttc
attgccaaatgggggctgggcgaagcgctcaaacgcgccgaagcctaccataaagcgggg
gcggatgccttgttgatccacagcaaactgtcgacggcggaagagatcctggccttcatg
aacgaatggcaggatacctgtcccatcgttgtggtcccgaccaagtattacacgacaccg
acctcggtatttcaagaggccggtatcagtctggtgatctgggccaaccagctgctgcgc
tcgagcgtagccgccatgcagaaaaccgcggccataattcatgaacaacagtcgctgctc
ggggtcgaaaaagagatcaccccggtaaaggaagtcttccgtttacaaaacaccgacgaa
ctgaaaaaggccgaggaacgttatctgccaccgacccgcacccccgatccctccggcgga
taa

DBGET integrated database retrieval system