KEGG   Pelobacter carbinolicus: Pcar_2199Help
Entry
Pcar_2199         CDS       T00285                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00473  D-Alanine metabolism
pca00550  Peptidoglycan biosynthesis
pca01100  Metabolic pathways
pca01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Pcar_2199 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pcar_2199 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Pcar_2199 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pca01011]
    Pcar_2199 (ddl)
Enzymes [BR:pca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Pcar_2199 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:pca01011]
 Precursor biosynthesis
  Amino acid ligase
   Pcar_2199 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 RimK ATP-grasp_4 ATP-grasp GARS_A DUF2099
Motif
Other DBs
NCBI-ProteinID: ABA89438
UniProt: Q3A2G9
LinkDB All DBs
Position
complement(2570162..2571079)
Genome map
AA seq 305 aa AA seqDB search
MQRQELQQKKIAVLMGGLSAEREVSLRTGKAISQALTRCGYEVTDIDAGRDLAQQLEKTG
VEVAFIALHGRFGEDGTVQGLLELADIPYTGSGVLASSLAMDKVATKKMLCYHGIATPGF
AVMRRGQKICGTLPDYPLVVKPAREGSTIGISIVHDEQELAAGLEEAFRHDDLVLVEQFI
AGAEVTVGVLDGQPLPIIQVVPKGGFYDYQSKYTPGQTEYLLPAPLPETLYGALQDSAVR
VFEAIGCCGAARVDFMVTDTGFYCLEVNTIPGMTETSLLPKAANAVGMSFDELVERILAG
ASLRK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccaggaactacaacagaagaaaatcgccgtattgatgggaggcctttccgcc
gaacgcgaggtgtctctgcgtacgggaaaagccatcagtcaggccctcacccgctgcggg
tatgaagtgaccgatatcgatgccggccgcgatctggcgcaacagctggaaaagaccggt
gtcgaggtcgcattcatcgccctgcacggtcgcttcggcgaggacggcacggtacagggg
ctgttggaactggcggatatcccttataccggtagcggtgtgctggcttccagtcttgcc
atggataaagtggcgaccaaaaagatgctctgttaccacggcattgccactcccggattc
gctgttatgcgtcgcggccagaagatctgcggaaccttgcccgactatccgctggtagtc
aaacccgccagagagggatcgaccatcggtatcagcattgtgcatgatgagcaagagctt
gccgccggactcgaggaggcctttcgtcacgatgatctggtgctggtagagcagttcatc
gccggggctgaagttaccgtcggcgtattggatggtcagccgttgccgattattcaggtg
gttcccaaagggggcttctacgactaccagtccaaatacacgcccgggcagaccgaatac
ctgttgccggcgcctttgcccgagaccctttacggtgccctgcaggattctgcggtccgg
gttttcgaagccattggatgttgtggtgcggcgcgtgtcgattttatggtgaccgatacc
ggtttttattgtctggaagtcaacaccatccccggaatgaccgagaccagtcttctgcct
aaagccgccaatgcggtcgggatgtcttttgacgaactcgttgagcgtattcttgcgggc
gcttctttgcgcaaataa

DBGET integrated database retrieval system