KEGG   Pelobacter carbinolicus: Pcar_2234Help
Entry
Pcar_2234         CDS       T00285                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00473  D-Alanine metabolism
pca01100  Metabolic pathways
pca01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Pcar_2234 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Pcar_2234 (alr)
Enzymes [BR:pca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Pcar_2234 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:pca01011]
 Precursor biosynthesis
  Racemase
   Pcar_2234 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABA89473
UniProt: Q3A2D4
LinkDB All DBs
Position
complement(2606300..2607436)
Genome map
AA seq 378 aa AA seqDB search
MNDPRAHRPTRVEIDLEALKHNFYQAQRLAGPGQGVLAVVKADAYGHGAAHVAMALQGVG
VEMFGVAIVEEGVALREAGVVCPILVLGGLYPGQEENLLRYGLVPTLFDMDVARRLDSCA
RAAGVVLPYHMKVDTGMSRVGFRPDDLPRVLEELGALSGLRMDGLFSHLAMADEPENTVN
QKQLEIFRGCLDRVRQAGFAPRYVHLSNSAALLTREVPECNLSRPGILLYGALPSPAFAG
RFDLKPVMSFRTRIAQIRKVPEGTGVSYGHRFVAERPTVLAVIPVGYADGYSRQLSNVGE
MLVRGQRARVAGTVCMDWTMIDVTDIPDVAVGDEVTLLGCDNGQCITADEWAERIGTISY
EVFCQFSKRVPRLTNDRR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatccccgggcgcatcgccccacccgcgttgaaatcgatcttgaggcgctaaaa
cataacttttaccaggctcaacggctggcaggaccggggcagggtgtcctggccgtggtc
aaggcggatgcctacggtcatggcgcggcgcatgttgccatggccttgcagggtgtcggg
gtggagatgttcggcgtggccattgtggaggaaggcgttgccttgcgcgaggcgggagtc
gtttgtcctatcctggtgcttggcggcctttatcccggccaggaggaaaatctgctgcgc
tacggtctggtgccgactcttttcgatatggacgtcgcccggcggctggacagctgtgcg
cgggcggccggtgtggttctgccttatcatatgaaggtcgataccggtatgagtcgcgtc
ggtttccggccggatgatctgccccgggtgctggaagaactgggtgcgctttcggggttg
cgcatggatggactgttctcccatctggctatggctgatgagccggaaaatacggttaat
cagaagcagcttgagatcttccggggctgccttgaccgagtcaggcaggccggttttgcg
ccgcggtatgtgcacttgagcaacagtgccgcattgttgacgagggaagtgcccgaatgc
aatttgtcgcgccccggtatcctgctttacggtgctttgcccagtccggcttttgccggg
cggttcgatttgaagccggtgatgagttttcgcacccgtattgcacagatccgcaaggtg
ccggaaggcacaggggtttcttatgggcatcgtttcgtggctgaacgcccgacggtactg
gcggttattccggtgggatatgccgatggctacagccgacagctttccaatgtcggcgaa
atgttggtgcgcggtcagcgtgcccgggtcgccgggacggtctgtatggactggaccatg
atcgatgtgacggatatccctgacgtggccgttggcgatgaggttaccctgcttggttgc
gacaacggtcaatgcatcaccgctgatgaatgggccgagcgcatcgggaccatcagttac
gaagtgttctgccagttcagtaagcgcgtgccgcgcctgaccaacgatcgccggtga

DBGET integrated database retrieval system