KEGG   Pelobacter carbinolicus: Pcar_2790Help
Entry
Pcar_2790         CDS       T00285                                 

Gene name
pgaC
Definition
(GenBank) UDP-N-acetylglucosamine--poly-1,6-beta-N-acetylglucosamine N-acetylglucosaminyltransferase
  KO
K11936  poly-beta-1,6-N-acetyl-D-glucosamine synthase [EC:2.4.1.-]
Organism
pca  Pelobacter carbinolicus
Brite
KEGG Orthology (KO) [BR:pca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pca01003]
    Pcar_2790 (pgaC)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pca02000]
    Pcar_2790 (pgaC)
Enzymes [BR:pca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     Pcar_2790 (pgaC)
Glycosyltransferases [BR:pca01003]
 Polysaccharide
  Bacterial polysaccharide
   Pcar_2790 (pgaC)
Transporters [BR:pca02000]
 Other Transporters
  Others
   Pcar_2790 (pgaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Chitin_synth_2 Glyco_tranf_2_2 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: ABA90025
UniProt: Q3A0T2
LinkDB All DBs
Position
complement(3253169..3254425)
Genome map
AA seq 418 aa AA seqDB search
MEPIFFILQALLDFVFYYPLFMAYLWMVGGLDYYLRREYRKARPDELPSLSSYPLVSIIV
PCHNEAEHLHDTIGYLFHQRYPDYEVIAVNDGSTDETGRMLDDMARENPQLRVVHFETNQ
GKAMGLRMASLVARGEFLVCIDGDALLDPDAIFWMMQHFLEGPRVGAVTGNPRIRTRSTL
LGKIQVGEFSAILGLIKRAQRVYGRVFTMSGVVSAFRKTALHHVGYWSVDMMTEDIDISW
RLQLSHWDIRFEPNALCWILMPETLKGLWNQRLRWAQGGSEVLLRYLRHMFKWRSRRMWG
VYFEYFTSIIWSYAMLLIGLIWLWGLFFPLPADMRLPTLVPAWSGVVLSLTCLLQFAVAM
FLDSRYERGLGRCYYVMIWYPLAFWLINMFTIVVGLPKALLKKRGERAVWTATDRGIY
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgatatttttcatcttacaggcgttgctcgactttgtgttttattatccgtta
ttcatggcttatctgtggatggtcgggggactcgattattatctgcgtcgcgagtaccgc
aaggcacgacctgacgaacttcccagcttatcatcctatcccctggtctcgattattgtt
ccgtgtcacaacgaagcagaacatctacacgataccatcggctatctgtttcatcagcga
tatcccgattacgaggttatagccgttaacgacggcagtaccgatgagaccgggcggatg
ctcgacgatatggcccgggaaaatccgcaactgcgggtggtgcatttcgagaccaatcaa
ggcaaggccatgggattacgcatggcgtcgctggtggcccggggggaatttctggtttgt
atcgacggcgacgcactgctggatcccgatgcgattttctggatgatgcagcattttctg
gaaggtccccgggttggcgctgtcaccggtaatccccgcatccgtacccgttcgacgctg
ttgggcaaaatccaggttggggagttttccgccatcctcgggcttatcaaacgggcccag
cgcgtttacggaagggtttttaccatgtccggcgtggtttccgcattccgtaaaacggca
ctgcatcatgtcggttactggagtgtcgacatgatgaccgaggatatcgatatcagctgg
cgtttacagcttagtcactgggatatccgttttgagccgaatgccctgtgctggattctg
atgccggaaaccctcaaaggcttgtggaaccagcggctgcgctgggcgcagggtggtagc
gaggtattgttgcgttacctgcgtcatatgtttaaatggcgctcgcgccgaatgtggggg
gtctattttgaatattttacgagtattatctggtcgtacgccatgttacttatcgggttg
atatggctttgggggttgttctttcccctgcctgccgatatgcggcttccgacccttgtt
ccggcatggtccggtgtggttttgagtctgacctgcctgttacagttcgcggtggcgatg
tttctcgattcccgctatgaacgaggtctggggcgctgttattacgtgatgatctggtac
ccgctggcattctggctcattaatatgtttaccatcgtcgtagggttgccaaaagcattg
ctgaaaaaacgcggcgaacgtgcagtctggaccgcgaccgaccgcggaatttattag

DBGET integrated database retrieval system