KEGG   Pelobacter carbinolicus: Pcar_2814
Entry
Pcar_2814         CDS       T00285                                 

Gene name
tssB
Definition
(GenBank) type VI secretion system needle sheath protein TssB
  KO
K11901  type VI secretion system protein ImpB
Organism
pca  Pelobacter carbinolicus
Brite
KEGG Orthology (KO) [BR:pca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pca02044]
    Pcar_2814 (tssB)
Secretion system [BR:pca02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pcar_2814 (tssB)
SSDB
Motif
Pfam: T6SS_VipA SMG1
Other DBs
NCBI-ProteinID: ABA90049
UniProt: Q3A0Q8
LinkDB
Position
3284003..3284530
AA seq 175 aa
MSDSYQKEIPKARINLALDVETGGHQKKTELPLKMLVMGDFSNGKTKGKIADRQRININK
NNFESVMADLAPSVRFDVPNLLAKDGSDFSIDLAFQSMKDFRPDSVAHQIPEMHSLMAMR
NLLKDLKSNLLDNAKFRKKLEKIVSNQPQLEGLKQQLEKLLDDSNETSNLEIRSY
NT seq 528 nt   +upstreamnt  +downstreamnt
atgagcgacagttaccaaaaggaaatccctaaggcccgtatcaatttagcgctggatgtt
gaaaccgggggtcaccagaaaaagacggaacttcccttgaaaatgctggtgatgggggat
ttcagcaacggcaaaaccaaggggaaaatagccgaccgacagcggatcaacatcaacaag
aacaatttcgaatcggtcatggccgatctcgctccgagtgtccgcttcgacgtaccgaat
ctgttggccaaggacggcagcgatttttccatcgatctcgcctttcagtcgatgaaggat
ttccgcccggacagcgtagcgcatcagattcccgagatgcacagcctgatggcgatgcga
aatctgctaaaggatctaaaatcgaacctgctggacaacgccaagtttcgcaagaagctg
gaaaagatcgtcagcaaccagcctcaactggaaggtttgaagcagcaattggaaaagttg
ctggatgattccaatgaaacgtccaacctggaaatccgcagctactaa

DBGET integrated database retrieval system