KEGG   Physeter catodon (sperm whale): 102973179
Entry
102973179         CDS       T06011                                 

Gene name
RXRB
Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X1
  KO
K08525  retinoid X receptor beta
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03320  PPAR signaling pathway
pcad04659  Th17 cell differentiation
pcad04919  Thyroid hormone signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05216  Thyroid cancer
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102973179 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102973179 (RXRB)
   03320 PPAR signaling pathway
    102973179 (RXRB)
   04919 Thyroid hormone signaling pathway
    102973179 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    102973179 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102973179 (RXRB)
   05202 Transcriptional misregulation in cancer
    102973179 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    102973179 (RXRB)
   05216 Thyroid cancer
    102973179 (RXRB)
   05222 Small cell lung cancer
    102973179 (RXRB)
   05223 Non-small cell lung cancer
    102973179 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102973179 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pcad03310]
    102973179 (RXRB)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    102973179 (RXRB)
Nuclear receptors [BR:pcad03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   102973179 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 102973179
NCBI-ProteinID: XP_007107945
UniProt: A0A2Y9ETG3
LinkDB
Position
18
AA seq 540 aa
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAAVAAGEQQ
TPEPEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGAAPPSPPGPPLPPSAAASLGGSG
APPPPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPE
DVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDL
TYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPE
EMPVDRILEAELAVEQKSDQGVEGPGGTAGSGSSPNDPVTNICQAADKQLFTLVEWAKRI
PHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIF
DRSLSRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLET
YCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgtcttgggctgctcgcccgcccttcctcccccagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcgtcccggtggcggcggcgacgg
ccctggctggatcccgcagcagcagcagcggcggcggcggtggcagccggagaacaacaa
accccggagccggagccggagccgggggaggctggacgggacgggatgggcgacagcggg
cgggactcccgaagcccagacagttcctctccaaatccccttccccagggggccgctccc
ccttctcctccggggccacccttacccccttcagcagctgcatcccttggaggctctggg
gctccacccccacccccgatgccacccccgccactgggctcccccttcccggtcatcagc
tcttccatggggtcccctggtctgccccctccagctcccccaggattctccgggcctgtc
agcagtccccagattaactcaacagtgtcgctccctgggggtgggtctggcccccctgaa
gatgtgaagccaccagtcttaggggtccggggcctgcactgtccaccccctccaggtggc
cctggggctggcaaacggctatgtgcaatctgcggggaccgaagctcaggcaaacactac
ggggtttacagctgtgagggctgcaaaggcttcttcaagcgcaccatccgtaaggacctg
acctactcgtgccgggacaacaaggactgcacggtggacaagcgccagcggaaccgctgt
cagtactgccgctatcagaagtgcctggccactggcatgaagagggaggcggtacaggag
gagcgtcagcgggggaaggacaaggatggggatggggagggggctgggggagcccccgag
gagatgcctgtggacaggatcctggaggcagagcttgctgtggagcagaagagtgaccag
ggcgttgagggtcctgggggaaccgcgggtagcggcagcagcccaaatgaccctgtgact
aacatctgccaggcagctgacaaacagctcttcacacttgttgagtgggcaaagaggatc
ccacacttttcctccttgcctctggatgaccaggtcatactgctacgggcaggctggaac
gagctcctcattgcctccttctctcaccgatccatcgatgtccgagacggcatcctcctc
gccacaggtctgcacgtgcaccgcaactcagcccattccgcaggcgtgggagccatcttt
gatcggtccctctccagggtgctgacagagctagtgtccaaaatgcgtgacatgaggatg
gacaagacagaacttggctgcctgagggcaatcattctgttcaatccagatgccaagggc
ctctccaaccccagcgaggtagaggtcctgcgggagaaagtgtacgcgtccctggagacc
tattgcaaacagaagtaccctgagcagcagggccggtttgccaagctgctcttgcgtctt
cctgctctcaggtccataggccttaagtgtctagagcatctgtttttcttcaagctcata
ggcgacacccccatcgacaccttcctcatggagatgcttgaggctccccaccagctggcc
tga

KEGG   Physeter catodon (sperm whale): 102980836
Entry
102980836         CDS       T06011                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma isoform X1
  KO
K08526  retinoid X receptor gamma
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03320  PPAR signaling pathway
pcad04659  Th17 cell differentiation
pcad04919  Thyroid hormone signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05216  Thyroid cancer
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102980836 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102980836 (RXRG)
   03320 PPAR signaling pathway
    102980836 (RXRG)
   04919 Thyroid hormone signaling pathway
    102980836 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    102980836 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102980836 (RXRG)
   05202 Transcriptional misregulation in cancer
    102980836 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    102980836 (RXRG)
   05216 Thyroid cancer
    102980836 (RXRG)
   05222 Small cell lung cancer
    102980836 (RXRG)
   05223 Non-small cell lung cancer
    102980836 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102980836 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pcad03310]
    102980836 (RXRG)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    102980836 (RXRG)
Nuclear receptors [BR:pcad03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   102980836 (RXRG)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 102980836
NCBI-ProteinID: XP_028344506
UniProt: A0A455BKU0
LinkDB
Position
4
AA seq 340 aa
MNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLI
DKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERILEAE
LAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLR
AGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQM
DKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLLLRL
PALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgaactacccatccactagccctggctctctggttaaacacatctgtgccatctgtggg
gacagatcctcaggaaagcactacggtgtgtacagttgtgaaggctgcaaagggttcttc
aagagaaccataaggaaagacctcatctacacgtgtcgggataataaagactgcctcatt
gacaagcgtcagcgcaaccgctgccagtactgtcgctatcagaagtgcctggtcatgggc
atgaagagggaagctgtgcaagaagaaaggcagagaagccgggagagggctgagagtgag
gcagaatgtgccagtagtggccatgaagatatgcccgtggagaggattctggaggctgaa
cttgctgttgaaccaaagacagaatcctacggtgacatgaacatggagaattcgacaaat
gaccctgtcaccaacatatgccatgctgctgacaagcagctctttactctcgttgaatgg
gccaagcgtattccccacttctctgacctcaccttggaggaccaggtcattctgctccgg
gcagggtggaatgaattgctgatcgcctccttttcccaccgctcggtttctgtgcaggat
ggcatccttctggccacgggtttacacgtccaccggagcagtgcccacagtgctggggtt
ggctccatctttgacagagttctgactgagctggtctccaaaatgaaagacatgcagatg
gataagtcggagctggggtgcctacgagccatcgtgctatttaacccagatgccaagggt
ctgtccaacccctctgaggtggagactctgcgagagaaggtttatgccaccctcgaggcc
tacaccaagcagaagtacccagaacaaccaggcaggtttgccaagctgctgctgcgtctc
ccagccttgcgctccatcggcttgaaatgcctggagcacctcttcttcttcaagctcatc
ggggacacacccattgacaccttcctaatggagatgttggagaccccactgcagatcacc
tga

KEGG   Physeter catodon (sperm whale): 102992401
Entry
102992401         CDS       T06011                                 

Gene name
RXRA
Definition
(RefSeq) retinoic acid receptor RXR-alpha
  KO
K08524  retinoid X receptor alpha
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03320  PPAR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04659  Th17 cell differentiation
pcad04919  Thyroid hormone signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04932  Non-alcoholic fatty liver disease
pcad04976  Bile secretion
pcad05160  Hepatitis C
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05216  Thyroid cancer
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102992401 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102992401 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102992401 (RXRA)
   03320 PPAR signaling pathway
    102992401 (RXRA)
   04919 Thyroid hormone signaling pathway
    102992401 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    102992401 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    102992401 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102992401 (RXRA)
   05202 Transcriptional misregulation in cancer
    102992401 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    102992401 (RXRA)
   05216 Thyroid cancer
    102992401 (RXRA)
   05222 Small cell lung cancer
    102992401 (RXRA)
   05223 Non-small cell lung cancer
    102992401 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102992401 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102992401 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102992401 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pcad03310]
    102992401 (RXRA)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    102992401 (RXRA)
Nuclear receptors [BR:pcad03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   102992401 (RXRA)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 102992401
NCBI-ProteinID: XP_028353204
UniProt: A0A455BW26
LinkDB
Position
13
AA seq 439 aa
MAAPSLHPSLGPGISSSLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTP
TLGFGTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSS
GKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKRE
AVQEERQRGKDRAENEVESTSSANEDMPVEKILEAELAVEPKTETYVEANVGLNPSSPND
PVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDG
ILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGL
SNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQMT
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggccgccccctcgctgcacccctccctggggcccggcatcagctcctcgctcggctcc
ccgggacagctgcactcgcccatcagcaccctgagctcccccatcaacggcatgggcccg
cccttctcggtcatcagctcccccatgggcccccactccatgtccgtgcccaccacaccc
accctgggcttcggcaccggcagcccccagctcagctcgcccatgaaccccgtcagcagc
agcgaggacatcaagcccccgctgggcctcaacggtgtcctcaaagtcccggcccacccc
tcagggaacatggcgtccttcaccaagcacatctgtgctatctgcggggaccgctcctca
ggcaagcactacggggtgtacagctgcgagggctgcaagggcttcttcaagcggacggtg
cgcaaggacctgacctacacctgccgggacaacaaggactgcctgatcgacaagcggcag
cggaaccggtgccagtactgccgctaccagaagtgcctggccatgggcatgaagcgcgaa
gctgtgcaggaggagcggcagcggggcaaggaccgggctgagaacgaggtggagtccacg
agcagcgccaacgaggacatgcccgtggagaagatcctggaggccgagctggccgtcgag
cccaagaccgagacgtacgtggaggcaaatgtggggctgaaccccagctcgcccaatgac
cctgtcaccaacatctgccaagcggccgacaagcagctcttcaccctggtggagtgggcc
aagcggatcccgcacttctccgagctgcccctggacgaccaggtcatcctgctgcgggca
ggctggaacgaactgctcatcgcctccttctcccaccgctccatagccgtgaaggacggc
atcctcctggccaccgggctgcacgtccaccgcaatagcgcccacagcgcaggggtgggc
gccatctttgacagggtgctgacggagctggtgtccaagatgcgggacatgcagatggac
aagacggagctgggctgcctgcgcgccatcgtcctcttcaaccccgactccaaggggctc
tcaaacccggccgaggtggaggcgctccgcgagaaggtctacgcgtccctggaggcgtac
tgcaaacacaagtaccccgagcagccaggaaggtttgccaagctgctgcttcgtctgccc
gccctgcgctccatcggcctcaagtgcctggaacacctctttttcttcaaactcatcggg
gacacgcccatcgacaccttcctcatggagatgctggaagccccgcaccaaatgacttag

DBGET integrated database retrieval system