KEGG   Physeter catodon (sperm whale): 102973446
Entry
102973446         CDS       T06011                                 

Gene name
EIF4E2
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 2 isoform X2
  KO
K03259  translation initiation factor 4E
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad03013  RNA transport
pcad04066  HIF-1 signaling pathway
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04211  Longevity regulating pathway
pcad04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102973446 (EIF4E2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102973446 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    102973446 (EIF4E2)
   04150 mTOR signaling pathway
    102973446 (EIF4E2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102973446 (EIF4E2)
  09149 Aging
   04211 Longevity regulating pathway
    102973446 (EIF4E2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102973446 (EIF4E2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102973446 (EIF4E2)
   03012 Translation factors [BR:pcad03012]
    102973446 (EIF4E2)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     102973446 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102973446 (EIF4E2)
Translation factors [BR:pcad03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    102973446 (EIF4E2)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 102973446
NCBI-ProteinID: XP_007125088
UniProt: A0A2Y9FLS0
LinkDB
Position
Unknown
AA seq 245 aa
MNNKFDALKDDDSGDHDQNEENGAQKDGEKEKTERDKSQSSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNVKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKP
RLNVP
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaacaacaagttcgacgcattgaaagacgacgacagcggggaccatgatcagaatgaa
gaaaacggcgcacagaaagatggtgagaaggaaaaaacggagcgagacaagagtcagagc
agcagcaagaggaaggctgttgtccctgggccagcagagcaccccctgcagtataactac
actttctggtactccaggagaacccctggccgccccaccagctcacagagctacgagcag
aatgtcaaacagattggcacctttgcctctgtggagcagttctggaggttttacagccac
atggtacgtcccggggacctgacaggccacagtgacttccatctcttcaaagaaggaatt
aaacccatgtgggaggatgatgcaaataaaaatggtggcaagtggattattcggctgcgg
aagggcttggcatcccgttgctgggagaatctcatcctggccatgttgggggaacagttc
atggttggggaggagatctgtggggccgtggtctctgtccggtttcaggaggacattatt
tcaatatggaataagactgccagcgaccaagccaccacagcccgcatccgggatacgctt
cggcgagtgcttaacctacctcccaacaccattatggaatacaaaacccacaccgacagc
atcaaaatgccaggcaggctgggcccccaaaggctcctttttcaaaacctctggaagccg
cggttgaatgtgccatga

KEGG   Physeter catodon (sperm whale): 102977142
Entry
102977142         CDS       T06011                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad03013  RNA transport
pcad04066  HIF-1 signaling pathway
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04211  Longevity regulating pathway
pcad04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102977142 (EIF4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102977142 (EIF4E)
   04151 PI3K-Akt signaling pathway
    102977142 (EIF4E)
   04150 mTOR signaling pathway
    102977142 (EIF4E)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102977142 (EIF4E)
  09149 Aging
   04211 Longevity regulating pathway
    102977142 (EIF4E)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102977142 (EIF4E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102977142 (EIF4E)
   03012 Translation factors [BR:pcad03012]
    102977142 (EIF4E)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     102977142 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102977142 (EIF4E)
Translation factors [BR:pcad03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    102977142 (EIF4E)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 102977142
NCBI-ProteinID: XP_023982359
UniProt: A0A2Y9T2P7
LinkDB
Position
7
AA seq 307 aa
MRGENRPLNAGPQRGRATQGKSASAPSPHGRGCPRPYPACAPRGRGPVGPQTPRRREGAA
ALQTVGRRKRGRRDRGGKRRRAVVRSDRSKMATVEPETTPTPNPPPTEEEKTESNQEVAN
PEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCD
YSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVC
GAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGST
TKNRFVV
NT seq 924 nt   +upstreamnt  +downstreamnt
atgcgcggtgagaaccggcccctcaacgcggggccccagcgcggccgagcgacccaaggc
aagtccgcttccgcccccagcccacatggccgcggctgcccgcgcccgtacccagcgtgc
gccccgcgcggccggggtccggtggggccccagaccccccggaggagagagggggcggcg
gcgcttcagactgtggggaggaggaagcgcggccggcgcgaccgcggggggaagaggagg
agagcggttgtgcgatcagatcgatctaagatggcgactgtggaaccggaaaccacccct
actcctaatcccccacctacagaagaagagaaaacagaatctaatcaggaggttgctaac
ccagaacactatattaaacatcctttacagaacagatgggcactctggttttttaaaaat
gataaaagcaaaacttggcaagcaaaccttcggctgatctctaagtttgatactgttgaa
gacttttgggctctgtacaaccatatccagttgtctagtaatttaatgcctggctgtgac
tactcactttttaaggatggtattgagcctatgtgggaagatgagaaaaacaaacgagga
ggacgatggctaattacattgaacaaacagcagagacgaagtgacctcgatcgcttttgg
ctagagacactgctgtgccttattggagagtcttttgatgactacagtgatgatgtatgt
ggagctgtggttaatgttagagctaaaggtgataaaatagcaatatggactactgaatgt
gaaaacagagaagctgttacacatatagggagggtatacaaggaacggttaggacttcct
ccaaagatagtgattggttatcagtcccatgcagacacagctactaagagcggctccacc
actaaaaataggtttgttgtttaa

KEGG   Physeter catodon (sperm whale): 102986704
Entry
102986704         CDS       T06011                                 

Gene name
EIF4E1B
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 1B
  KO
K03259  translation initiation factor 4E
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad03013  RNA transport
pcad04066  HIF-1 signaling pathway
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04211  Longevity regulating pathway
pcad04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102986704 (EIF4E1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102986704 (EIF4E1B)
   04151 PI3K-Akt signaling pathway
    102986704 (EIF4E1B)
   04150 mTOR signaling pathway
    102986704 (EIF4E1B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102986704 (EIF4E1B)
  09149 Aging
   04211 Longevity regulating pathway
    102986704 (EIF4E1B)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102986704 (EIF4E1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102986704 (EIF4E1B)
   03012 Translation factors [BR:pcad03012]
    102986704 (EIF4E1B)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     102986704 (EIF4E1B)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102986704 (EIF4E1B)
Translation factors [BR:pcad03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    102986704 (EIF4E1B)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 102986704
NCBI-ProteinID: XP_007103239
UniProt: A0A2Y9EI32
LinkDB
Position
2
AA seq 251 aa
MTGALALVIHAQVENTQMAQEAKEAGGGIQKWKKEKEEKEEEEAAAGVRVGEEALRKARA
EGPVESKLELHPLLNRWALWFFKNDRSRAWQDNLHLVTKFDTVEDFWATYNNIQLASKLS
SGCDYALFKDGIEPMWEDSRNRRGGRWLVSLAKQQRHSELDHLWLETLLCLIGESFEEHS
REVCGAVINIRTKGDKIAVWTRETENQEGVLRIGRVYKERLGLSTKTIIGYQAHADTAAK
SNSLAKNKFVV
NT seq 756 nt   +upstreamnt  +downstreamnt
atgacaggtgcactggccctcgtcatccatgcccaggtggaaaacactcagatggcccag
gaggccaaagaggctgggggtggaatccaaaagtggaagaaagagaaggaggagaaagag
gaagaggaggcagcagcgggggtgcgggtgggagaggaggctctgaggaaggcccgggcc
gaaggccccgtggagagcaagctggagttgcacccactgctgaacaggtgggctctgtgg
ttcttcaagaatgaccgcagcagggcctggcaggacaacctgcatctggtcaccaagttt
gacaccgtggaggacttctgggcgacgtacaataacatccagctggccagtaagctctct
tctggctgtgactacgccctgttcaaggatggtattgagcccatgtgggaagacagcagg
aataggcggggtggccgctggctggtcagcctcgccaagcagcagcgccacagtgagctg
gaccacctatggctggagacgctgctgtgtctgatcggggagagctttgaggagcacagc
cgggaggtgtgtggggccgtcatcaacatccgaaccaagggggacaagattgccgtgtgg
acgagggagacagagaaccaggagggcgtgctgcgcattgggcgtgtctacaaagagcgc
ctgggactctccacaaagaccatcattgggtaccaggcccacgcagacacggccgccaag
agcaactccctagccaagaacaaatttgtggtgtag

DBGET integrated database retrieval system