KEGG   Physeter catodon (sperm whale): 102973482
Entry
102973482         CDS       T06011                                 

Gene name
CTNNA2
Definition
(RefSeq) catenin alpha-2 isoform X3
  KO
K05691  catenin alpha
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04390  Hippo signaling pathway
pcad04520  Adherens junction
pcad04670  Leukocyte transendothelial migration
pcad05100  Bacterial invasion of epithelial cells
pcad05200  Pathways in cancer
pcad05213  Endometrial cancer
pcad05226  Gastric cancer
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102973482 (CTNNA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102973482 (CTNNA2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102973482 (CTNNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102973482 (CTNNA2)
  09162 Cancer: specific types
   05226 Gastric cancer
    102973482 (CTNNA2)
   05213 Endometrial cancer
    102973482 (CTNNA2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102973482 (CTNNA2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102973482 (CTNNA2)
Cytoskeleton proteins [BR:pcad04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     102973482 (CTNNA2)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 102973482
NCBI-ProteinID: XP_023985627
UniProt: A0A2Y9T7N6
LinkDB
Position
12
AA seq 965 aa
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLRIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNCRYGMWAQ
QSCKTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKS
GNEKEVKEYAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALT
LAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIAL
QEGDVDTLDRTAGAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQ
VEVAIEALSANVPQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYD
VRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSG
NDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPD
SACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSNFTTFYEVDCDVI
DGGRASQLSTHLPTCAEGAPIGCGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVAST
KYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFK
AMDSF
NT seq 2898 nt   +upstreamnt  +downstreamnt
atgacgtcggcaacttcacctatcatattaaaatgggaccccaaaagtttggaaatccgg
actctaacagtggagagacttttggagccacttgttacacaggtgacgacccttgtcaac
acaagcaacaaaggcccatctggtaaaaagaaagggaggtcaaagaaagcccatgtactg
gctgcatctgtagagcaagccactcagaactttctggaaaagggtgagcagatcgctaag
gagagtcaagatctcaaagaagaattggttgctgctgttgaggatgtacgcaaacaaggc
gagacgatgcgtatcgcctcttcagagttcgctgatgacccgtgttcctcggtgaagcgt
ggtaccatggtgcgagctgcccgggctctgctatcggctgtaacgcgcttgctcatcctg
gcggacatggcagacgtcatgagacttttatctcatctgagaattgtggaggaggccttg
gaagctgtcaaaaatgctacaaatgagcaagaccttgcaaatcgctttaaagaatttgga
aaagagatggtgaaacttaattatgtagctgcaagaagacaacaggagctgaaggaccct
cactgtcgggatgagatggcagctgcccgaggggctctaaagaagaacgccacaatgctg
tacacagcctcccaagcctttctccgccacccagacgttgccgccaccagagccaaccga
gattacgtgttcaaacaagtgcaggaggccattgccggcatctccaatgctgctcaagct
acctcgcccaccgacgaagccaaaggccacacgggcatcggggagctggctgcggctctg
aacgaatttgacaacaagatcatcctggaccccatgacgttcagcgaggcccggttccgg
ccgtccctagaggagcgcctggagagcatcatcagcggcgcggctctcatggccgactcc
tcgtgcacccgcgacgaccggcgcgagcggatcgtggccgagtgcaacgccgtgcgccag
gcgctccaggacctgctcagcgagtacatgaacaactgccgttatggcatgtgggctcag
caaagttgtaagactggaagaaaagaaaaaggagatcctctaaacattgcaattgataag
atgaccaagaaaacaagggatctaaggagacagcttcggaaagcagtgatggatcacata
tctgattctttcttggaaaccaacgtccctttgctagttctcattgaggctgcaaaaagt
gggaatgagaaggaagtgaaggaatacgcccaggttttccgcgagcatgccaacaagctg
gtggaggttgccaatttggcctgttccatctccaataatgaagaaggggtgaaattagtt
cggatggcagccacccagattgacagcctgtgtccccaggtcatcaatgccgctctcaca
ctggctgcccggccacagagcaaagttgctcaggacaatatggatgtcttcaaagaccag
tgggaaaaacaggtccgagtgctgacagaggctgtggatgacatcacctcagtggatgac
ttcctttctgtctcagaaaatcatatcttggaggatgtgaacaagtgtgtgatagccctt
caagagggggatgtggacactctggaccggactgcaggggctatcaggggccgggcagct
cgagtcatacacatcatcaatgctgagatggagaactatgaagctggagtttatactgag
aaggtgctggaagctacaaaattgctctctgagacagtgatgccacgctttgctgaacaa
gtggaggttgccattgaagccctgagtgccaatgtccctcaaccatttgaagagaacgag
ttcatcgatgcttctcgcctggtatacgacggcgttcgggacatcagaaaggctgtgctg
atgatcaggaccccagaagaactagaggatgattcagactttgagcaggaagattatgat
gtacgtagccggacaagtgttcagacggaggacgaccagctcattgcagggcagagtgca
cgggccatcatggcacaactaccgcaagaggagaaggcaaaaatagctgagcaggtggag
atattccaccaagagaaaagcaagctggatgctgaagtggccaaatgggacgacagtggc
aatgatatcattgtgctggccaagcagatgtgtatgatcatgatggaaatgacagacttc
acaagaggcaaaggcccgttgaaaaatacatctgatgtgattaatgctgccaagaaaatt
gccgaagcaggctctcgaatggacaaattagcccgagctgtggctgatcagtgtcctgat
tcagcatgtaagcaggatttattagcctaccttcaacgaattgccttgtattgccatcaa
cttaatatctgcagcaaggtgaaagccgaagtacagaatctgggaggagagctcattgtg
tcagggacaggagttcagagcaatttcactaccttttatgaggtagattgtgatgtcata
gatgggggcagggctagtcaactttctacccacctcccaacctgtgctgagggagctccg
atcgggtgtggaagcagtgattcttccatgctggacagtgccacatcactcatccaggca
gctaaaaatctgatgaatgctgttgtcctcacggtgaaagcatcttatgtggcctcaaca
aaatatcagaaggtctatgggacagcagctgtcaactcacctgttgtgtcttggaagatg
aaggctccagagaagaagccccttgtgaagagagaaaagcctgaagaattccagacgcga
gttagacgaggttctcagaagaaacacatttctcctgtacaggctttaagtgaattcaaa
gcaatggattccttctag

KEGG   Physeter catodon (sperm whale): 102980163
Entry
102980163         CDS       T06011                                 

Gene name
CTNNA1
Definition
(RefSeq) catenin alpha-1
  KO
K05691  catenin alpha
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04390  Hippo signaling pathway
pcad04520  Adherens junction
pcad04670  Leukocyte transendothelial migration
pcad05100  Bacterial invasion of epithelial cells
pcad05200  Pathways in cancer
pcad05213  Endometrial cancer
pcad05226  Gastric cancer
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102980163 (CTNNA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102980163 (CTNNA1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102980163 (CTNNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102980163 (CTNNA1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102980163 (CTNNA1)
   05213 Endometrial cancer
    102980163 (CTNNA1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102980163 (CTNNA1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102980163 (CTNNA1)
Cytoskeleton proteins [BR:pcad04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     102980163 (CTNNA1)
SSDB
Motif
Pfam: Vinculin Peptidase_C5
Other DBs
NCBI-GeneID: 102980163
NCBI-ProteinID: XP_007108999
UniProt: A0A2Y9EUK2
LinkDB
Position
8
AA seq 906 aa
MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKSAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGTEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDMGHRDQMAAARGILQKNIPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgactgctgtccacgcaggcaacataaacttcaaatgggaccccaaaagtctagagatc
aggactctggcagttgaaagactgttggagcctcttgttacccaggttacaaccctggta
aacaccaatagcaaggggccctctaataagaagagaggtcgttctaagaaggcccatgtt
ttggctgcatctgttgaacaggcaactgagaatttcttggagaagggggataaaattgca
aaggagagtcagtttctcaaggaggagcttgtggctgctgtagaagatgttcgaaaacaa
ggtgatttgatgaagagtgctgctggagagtttgcagatgatccctgctcctctgtgaag
cgtggcaacatggttcgggcagctcgagctttgctctctgctgttacccggttgcttatt
ttggctgacatggcagatgtctacaaattacttgttcagctgaaagttgtagaagatggt
atcttgaaactgaggaatgctggcactgaacaggacttgggaatacaatataaggccctg
aaacccgaagtggataagctgaacattatggcagccaaaagacaacaggaactgaaagat
atgggccatcgtgatcagatggctgcagccagaggaatcctgcagaaaaacattccaatc
ctctatactgcatcccaggcatgcctacagcaccctgatgtcgcagcctataaggccaac
agagacctgatatataagcagctgcagcaggcggtcacaggcatttctaatgcagcccag
gctactgcatcagatgatgcctcccagcaccagggtggaggaggaggagaactggcatat
gccctcaataactttgataaacaaatcattgtggaccccttgagcttcagcgaggagcgc
tttaggccttccctggaggagcgcctggaaagcatcattagtggggctgccctgatggct
gattcatcctgcacacgtgatgaccggcgtgagagaatcgtggcagagtgtaatgctgtc
cgccaggccttgcaggacctgctctcggagtacatgggcaatgctggacgtaaagaaaga
agtgatgcactcaattctgcaatagataaaatgaccaagaagaccagggatttgcgtagg
cagctccgcaaagctgtcatggaccatgtttcagattcatttctggaaaccaacgttcca
cttttagtattgattgaagctgcaaagaatggaaatgagaaagaagttaaagaatatgcc
caagttttccgtgaacatgccaacaaattaattgaggttgccaacttggcctgttctatc
tcaaacaatgaagaaggtgtaaagcttgttcgaatgtctgcaagccagctagaagccctc
tgtcctcaggttatcaatgctgcattggctttagcagcaaaaccacagagtaaactggcc
caagagaacatggatctttttaaagaacagtgggaaaaacaagtccgagttctcacagat
gctgtcgatgacattacttccattgatgacttcttggctgtctcagagaatcacattttg
gaagacgtgaacaaatgcgtcattgctctccaagagaaagatgtggatgggctggaccgc
acagctggtgcaattcgaggccgggctgctcgggtcattcacgtggtcacctcagagatg
gacaactatgagccaggggtctacacagagaaggtgctggaagccaccaagctcctctcc
aacacagtcatgccacgttttaccgaacaagtggaagcggccgtggaagccctcagctcg
gaccccgcccagcccatggatgagaatgagtttatcgatgcctcacgcctggtgtacgat
ggcatccgggacatcaggaaagcggtgttgatgataaggacccctgaggagctggatgac
tcggacttcgagacggaagacttcgatgtcagaagcaggacaagcgtccagacagaagac
gatcagctgatagctggccagagtgcccgggcgatcatggctcagcttccccaggagcaa
aaagcaaagattgcagaacaggtggccagcttccaggaagaaaagagcaagctggatgcc
gaagtgtccaagtgggacgacagtggtaatgacatcattgtgctggccaagcagatgtgc
atgatcatgatggagatgacggactttacccgaggtaaaggaccgctcaaaaacacatca
gatgtgatcagtgccgccaagaaaattgctgaggcgggatcccggatggataagcttggc
cgtaccattgcagaccattgcccagactcagcctgcaagcaggacctgctggcctacctg
cagcgcatcgccctctactgccaccagctcaacatctgcagcaaagtcaaggctgaggtg
cagaacctcggtggggagctggtcgtctccggggtggacagcgccatgtccctgatccaa
gccgctaagaacttgatgaacgctgtggtgcagacagtgaaggcgtcctacgtggcctcc
accaaataccagaagtctcaggggatggcttcccttaacctccctgccgtgtcgtggaag
atgaaggcgcctgagaaaaagcccttggtgaagagagagaaacaggatgagacacagacc
aagattaagagggcatctcagaagaagcatgtgaaccctgtgcaggccctcagcgagttc
aaagccatggacagcatctaa

KEGG   Physeter catodon (sperm whale): 102995753
Entry
102995753         CDS       T06011                                 

Gene name
CTNNA3
Definition
(RefSeq) catenin alpha-3 isoform X3
  KO
K05691  catenin alpha
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04390  Hippo signaling pathway
pcad04520  Adherens junction
pcad04670  Leukocyte transendothelial migration
pcad05100  Bacterial invasion of epithelial cells
pcad05200  Pathways in cancer
pcad05213  Endometrial cancer
pcad05226  Gastric cancer
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102995753 (CTNNA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102995753 (CTNNA3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102995753 (CTNNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102995753 (CTNNA3)
  09162 Cancer: specific types
   05226 Gastric cancer
    102995753 (CTNNA3)
   05213 Endometrial cancer
    102995753 (CTNNA3)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102995753 (CTNNA3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102995753 (CTNNA3)
Cytoskeleton proteins [BR:pcad04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     102995753 (CTNNA3)
SSDB
Motif
Pfam: Vinculin AAA_32
Other DBs
NCBI-GeneID: 102995753
NCBI-ProteinID: XP_023987931
UniProt: A0A2Y9TAL7
LinkDB
Position
20
AA seq 895 aa
MSAETPITLNVNPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSNRKKGRSKRARVLLA
SVEEATWNLLDKGEKIAEEATVLKEELTGALEEVRKESEALKVSAERFADDPCYLPKREA
VVQAARALLAAVTRLLILADMIDVMCLLQHVSAFQRTFESLKNVSNKSDLQKTYQKLGKE
LENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPILHSVCSACLEHSDVASLKASKDT
VCEEIQNALNVISNASQGIQNVLVPPEPQAATLASALDELENLIVLDPLTVTEEETRPSL
EKRLEAIISGAALLADSSCTRDFHRERIIAECNAIRQALQDLLSEYMNNTGKKERSNTLN
IAIENMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIFRE
HTSRLVEVANLACSMSTNEDGIKIVKVAANHLETLCPQIINAALALAARPKSQVVKKTME
MYRCTWENHIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAI
RGRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTAIPEFVTQVNVALEALSKNSLDV
FDDSQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEDHEVRSHTSVQTEGKTDRA
KMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKKMCMIMMEMTDFTR
GKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLK
ICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAG
PRHPVVMWRMKAPAKKPLIKREKPEETYAAVRRGSAKKKIHPVQVMSEFRGRHIY
NT seq 2688 nt   +upstreamnt  +downstreamnt
atgtcagctgaaacaccaatcacactgaatgtcaatcctcaggatctgcaggtccagaca
ttcactgtagagaagctgctggagcctctcataatccaggttactacacttgtaaattgt
ccccagaatccttccaacaggaaaaaaggacgttcaaaaagagccagagtccttctagct
tctgtggaggaagcaacttggaatttattagacaagggagagaagattgctgaagaagcc
acagttttaaaggaagagcttactggggcacttgaggaagttcgcaaagaaagtgaagct
ctgaaagtatcagctgagagatttgcagatgatccctgttatctcccaaaaagggaggct
gtggttcaagctgcccgtgccttgttggctgcagttaccagactccttatcctcgcagat
atgattgatgtcatgtgtctcttgcagcacgtgtcagcttttcagaggacatttgagtct
cttaaaaatgtttccaacaaatctgacctccagaaaacttaccagaagcttgggaaggag
ctggaaaatctggactatttagccttcaaacgtcagcaggacctaaaatctccaaatcag
agggatgaaattgcaggtgcccgggcctcattgaaggagaactcccccatattgcattca
gtttgttcagcttgtttggaacattctgatgtcgcttccctcaaagccagcaaggacaca
gtttgtgaagaaattcagaatgccctcaatgtaatttcaaatgcttcacaaggcatccag
aatgtgttagtcccaccagaacctcaggcagcaaccctggcaagtgcccttgatgagctt
gagaatttaattgtcttggatccactcacagtgactgaggaggaaacaagaccatcccta
gagaaacgcctcgaagccattatcagtggggctgctctgttggctgactcttcatgcacg
agagatttccatcgggagagaattatcgcagaatgcaatgccattcgccaggctctccag
gacctgctttctgagtacatgaacaatactggaaaaaaggaaaggagtaataccttgaat
attgcaatagaaaacatgtgcaagaagacaagagaccttcgcagacagctccgtaaggct
attatagatcatgtgtcagactcctttctggatacgacagtcccacttttggttctcatt
gaagctgccaagaatggccgggaaaaggaaataaaagaatatgctgcgatatttcgtgaa
cacaccagcagacttgtagaggtggcaaatcttgcttgctccatgtcaacaaatgaagat
ggaattaagattgtcaaagttgcagccaatcacctggaaaccttgtgtccacagattatt
aatgctgcacttgctttggctgcaagacccaaaagtcaagtggtcaaaaaaaccatggaa
atgtacagatgcacgtgggagaatcatatccatgtcctcactgaagctgtagatgacatt
acaagcattgatgacttccttgctgtatctgagagccatatcctagaagatgtcaacaaa
tgtatcatagccttgagagaccaggatgctgataatttagatcgagctgcaggtgctatc
agaggacgggccgcaagagttgctcacattgtcacaggtgaaatggacagttatgagcca
ggagcttacacagaaggtgtgatgagaaatgttaacttcctgacaagtactgcaattccg
gaatttgtaacacaagtgaatgttgccttggaagccttaagtaaaaactctttggatgtg
tttgatgatagtcagtttgtggacatctcaaaaaagatctatgatacaattcatgatatc
agatgttcagtcatgatgattcggactccagaggaactagaggatgtttctgacctagaa
gaagatcacgaggtccgcagtcacaccagtgttcagactgaagggaaaactgaccgggct
aagatgactcaattgcctgaggcagaaaaggaaaagatagctgagcaagttgctgatttc
aagaaagtaaagagtaagctggatgctgagattgagatatgggacgatacgagcaacgat
atcattgttctcgccaagaagatgtgtatgatcatgatggagatgacagacttcacaagg
ggaaaaggaccactgaagcatacaactgatgtgatctatgcagctaaaatgatatcagaa
tcaggatcaaggatggacgtccttgctcggcagattgccaaccagtgcccagatccatca
tgcaaacaggacttgttggcctacctggaacagattaaattctactctcaccagctgaaa
atctgcagtcaagttaaagctgagatccagaacctgggaggagagctcatcatgtcagcg
ttggacagtgtcacctccctgatccaagcagccaaaaatttaatgaatgctgtagtgcaa
acagtgaaaatgtcttacattgcctcaaccaagatcatccgaattcagagtcctgctggg
ccccggcacccagttgttatgtggagaatgaaggctcctgccaaaaaacccttgattaaa
agagagaaaccagaggaaacttatgcagctgtcagacgaggctcagcaaagaaaaaaatc
cacccagtgcaagtgatgagtgaatttagaggaagacatatctactga

DBGET integrated database retrieval system