KEGG   Physeter catodon (sperm whale): 102973496
Entry
102973496         CDS       T06011                                 

Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04060  Cytokine-cytokine receptor interaction
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04630  JAK-STAT signaling pathway
pcad04640  Hematopoietic cell lineage
pcad04664  Fc epsilon RI signaling pathway
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05221  Acute myeloid leukemia
pcad05310  Asthma
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102973496
   04151 PI3K-Akt signaling pathway
    102973496
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102973496
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102973496
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102973496
   04664 Fc epsilon RI signaling pathway
    102973496
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102973496
   05202 Transcriptional misregulation in cancer
    102973496
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102973496
  09163 Immune disease
   05310 Asthma
    102973496
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcad04052]
    102973496
   00536 Glycosaminoglycan binding proteins [BR:pcad00536]
    102973496
Cytokines and growth factors [BR:pcad04052]
 Cytokines
  Interleukins
   102973496
Glycosaminoglycan binding proteins [BR:pcad00536]
 Heparan sulfate / Haparin
  Cytokines
   102973496
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 102973496
NCBI-ProteinID: XP_007120195
UniProt: A0A2Y9FD22
LinkDB
Position
8
AA seq 143 aa
MSSLPILYRLLFLFALHAPQAQGTPVTTPGTQRYYGNLIQEIVNELDKLPVASEVFLNSN
EKRRLMKTSLRKPNLEEFLTFATDSLGEDSKITKNLKEIQPILPTTMSTEEPILIEQDNL
GDFQVKLKEYLSAIRDSLNSKNT
NT seq 432 nt   +upstreamnt  +downstreamnt
atgagcagcctccccatcctgtatcggctcctgttcctgttcgcactccatgcccctcaa
gcacaagggacaccggtcacgacaccaggaactcaacgatactatggcaacctgatccag
gaaattgtaaatgagctagacaagctacctgtggcttcagaagtcttcttgaactcaaac
gagaagaggaggctgatgaaaacaagcctccggaagccaaacctggaagaattcctgaca
tttgccacagattcccttggagaggattcgaaaatcacgaaaaatcttaaggaaatccag
ccaatcctgcccacaaccatgtccacggaagagccaatccttattgagcaggataacttg
ggtgatttccaggtgaaactgaaggaatatctgtctgccattagagactctctgaattct
aagaacacatag

DBGET integrated database retrieval system