KEGG   Physeter catodon (sperm whale): 102973542
Entry
102973542         CDS       T06011                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04915  Estrogen signaling pathway
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05223  Non-small cell lung cancer
pcad05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102973542 (TGFA)
   04012 ErbB signaling pathway
    102973542 (TGFA)
   04014 Ras signaling pathway
    102973542 (TGFA)
   04151 PI3K-Akt signaling pathway
    102973542 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102973542 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102973542 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102973542 (TGFA)
   05212 Pancreatic cancer
    102973542 (TGFA)
   05225 Hepatocellular carcinoma
    102973542 (TGFA)
   05214 Glioma
    102973542 (TGFA)
   05211 Renal cell carcinoma
    102973542 (TGFA)
   05215 Prostate cancer
    102973542 (TGFA)
   05223 Non-small cell lung cancer
    102973542 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102973542 (TGFA)
SSDB
Motif
Pfam: EGF_2 EGF TMEM154
Other DBs
NCBI-GeneID: 102973542
NCBI-ProteinID: XP_007129001
UniProt: A0A2Y9FR72
LinkDB
Position
12
AA seq 160 aa
MVTSAGQLALFVLGLLLAVCQALENSTSALSADPPVAAAVVSHFNDCPASHSQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALTVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggttacctcagctggacagctcgccctcttcgtgctgggtcttttgttggctgtgtgc
caggccctggagaacagtacgtccgctctgagtgcagacccgcccgtggccgcagctgtg
gtgtcccattttaatgactgcccagcttcccacagtcagttctgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccactctgggtacgtcggtgca
cgctgtgaacatgcagacctcctggccgtggtggccgccagccagaagaagcaggccatt
actgccttggtggtggtctccatcgtggccctgactgtcctcatcatcacgtgtgtgctg
atacactgctgccaggtccgaaaacactgtgaatggtgccgggccctcatctgccggcac
gagaagcccagtgccctcctgaagggaaggactgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system