KEGG   Physeter catodon (sperm whale): 102973638
Entry
102973638         CDS       T06011                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin-A1
  KO
K06627  cyclin-A
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04152  AMPK signaling pathway
pcad04218  Cellular senescence
pcad04914  Progesterone-mediated oocyte maturation
pcad05161  Hepatitis B
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05203  Viral carcinogenesis
pcad05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102973638 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102973638 (CCNA1)
   04218 Cellular senescence
    102973638 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102973638 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102973638 (CCNA1)
   05202 Transcriptional misregulation in cancer
    102973638 (CCNA1)
   05203 Viral carcinogenesis
    102973638 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102973638 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102973638 (CCNA1)
   05161 Hepatitis B
    102973638 (CCNA1)
   05169 Epstein-Barr virus infection
    102973638 (CCNA1)
   05165 Human papillomavirus infection
    102973638 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pcad03032]
    102973638 (CCNA1)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102973638 (CCNA1)
DNA replication proteins [BR:pcad03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102973638 (CCNA1)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102973638 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102973638
NCBI-ProteinID: XP_007128927
UniProt: A0A2Y9FR21
LinkDB
Position
13
AA seq 421 aa
MHLSSSKSGVVLAPVSRGPDACQMITRAQLGQDPPQRTVLGVLTENGQYRRTCGQGITTL
RCFSGSENVFPPAGKKALSDSGVQVPAKQGLDMYVDEPEQGDRDSRTGREGMAFEDVCEV
DTSTLKSDLHFLLDFNTVSPMLVDSSLHSQSEDASDFGTDVINVTEYAEEIHQYLREAEV
RHRPKVHYMRKQPDITEGMRTILVDWLVEVGEEYKFRAETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAALLLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLTFDLTVPTT
NQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAYCLANYTVNRHFW
PETLATFTGYSLSEIVPCLSELHKVCLGIPHRPQQAIREKYKASKYMHVSLVEPPAVLPL
R
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcatctcagcagctccaagagtggagtagtgctggctccggtgtcccgaggtcctgat
gcctgtcagatgataaccagagcccagcttggccaggatccgccacaaagaacagtacta
ggggtgctaactgagaatgggcagtacaggaggacctgtggccaggggatcacaacactc
aggtgtttctctgggtcagaaaatgtcttccctccagctggaaagaaagctctgtctgac
agcggggttcaggtgccagccaagcaaggacttgacatgtacgtggacgagcctgagcaa
ggggacagagacagccgcacagggcgagaggggatggcatttgaggacgtctgtgaagta
gacaccagcacactcaagtcagaccttcacttcctgctggattttaacacagtttcccct
atgctggtagattcatctctccactcccagtctgaagatgcatcagattttggtacagat
gtgataaatgtgactgaatatgctgaagaaattcatcagtaccttagagaagctgaagta
agacacaggcccaaagtgcactacatgaggaaacaaccagacatcacagaaggcatgcga
acaattctggtggactggctggttgaggtgggagaagaatataagtttcgggcagagact
ctctacctggccgtcaacttcctggacaggtttctttcctgcatgtctgttctgagaggg
aaactgcagcttgtaggaacagcagctcttctcctggcttcgaaatatgaagaaatatat
ccacctgaagtagatgagtttgtctatataactgatgatacctacacaaaacgacaactg
ctgagaatggaacacctgctcctgaaggtcctgacttttgacctgaccgtgccaaccacc
aaccagtttctccttcagtacttaaggaggcaaggggtgtgtgtcaggactgagaacctg
gccaagtatgtagcagaactgagtctccttgaagctgacccattcttgaaataccttcct
tcactgatcgctgcagctgcttattgcctggcaaactatactgtgaacaggcacttctgg
ccagaaacccttgctacgtttacaggctattcattaagtgaaattgtgccttgcctgagt
gagctgcataaagtgtgcctgggtattccccatcgacctcagcaagcgattagggagaag
tacaaggcttcaaagtacatgcacgtgtctctcgtggaaccacccgcagtccttcctcta
cgataa

KEGG   Physeter catodon (sperm whale): 102986587
Entry
102986587         CDS       T06011                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04152  AMPK signaling pathway
pcad04218  Cellular senescence
pcad04914  Progesterone-mediated oocyte maturation
pcad05161  Hepatitis B
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05203  Viral carcinogenesis
pcad05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102986587 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102986587 (CCNA2)
   04218 Cellular senescence
    102986587 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102986587 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102986587 (CCNA2)
   05202 Transcriptional misregulation in cancer
    102986587 (CCNA2)
   05203 Viral carcinogenesis
    102986587 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102986587 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102986587 (CCNA2)
   05161 Hepatitis B
    102986587 (CCNA2)
   05169 Epstein-Barr virus infection
    102986587 (CCNA2)
   05165 Human papillomavirus infection
    102986587 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pcad03032]
    102986587 (CCNA2)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102986587 (CCNA2)
DNA replication proteins [BR:pcad03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102986587 (CCNA2)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102986587 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N2 Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102986587
NCBI-ProteinID: XP_007120510
UniProt: A0A2Y9FDS9
LinkDB
Position
7
AA seq 432 aa
MLGSSAPGPAAREAGSALLTLQQTALQEDQENINPEKAAPTQQSRTRAGLAVLKAGNSRG
PAPQQRPKTRRVAPLKDLPINDEHVTVPPWKANSQQPAFTIHVDEAEEETQKRPVESKKP
ESEDVLAFNSAVTLPGPRKPLVPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLAFDLAAPTINQFLTQYFLHQQSANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAF
HLALYTVTGQSWPESLVQKTGYTLETLKPCLTDLHQTYLRAPRHAQQSIREKYKNSKYHG
VSLLNPPETLNV
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgttgggcagctccgcgcccgggcctgcggcccgcgaggcaggctcggcgctgttaaca
ttgcagcagacggcgctccaggaggaccaggagaacatcaaccccgagaaggcggcgccc
acccagcagtcccggacccgcgctgggctggcggtactgaaggccgggaattcgcgggga
ccagcgccgcagcagaggcctaagacgcgacgggttgcacctcttaaggatcttcctata
aatgatgagcatgtcaccgttcctccctggaaagcaaacagtcaacagcctgcatttacc
attcatgtggatgaagcagaagaagagactcaaaagaggccagttgaatctaaaaaacca
gaaagtgaagatgtcttggcttttaattcagctgttactttaccaggaccaagaaaacca
ctggtacctcttgattacccaatggatggtagttttgagtcaccacatactatggatatg
tcaattgtattggaagatgaaaagccagtgagtgttaatgaagtgccagactaccatgag
gacattcacacataccttagggaaatggaggttaaatgtaagcctaaagtgggttacatg
aagaaacagccagacattactaacagtatgagggctatcctcgtggactggttagttgaa
gtaggagaagaatataaactacagaatgagaccctgcatttggctgtgaactacattgat
aggtttctttcatcgatgtctgtgttgagaggaaaacttcagcttgtgggcactgctgct
atgctgttagcctcaaagtttgaagaaatataccccccagaagtagcagagtttgtatac
attacagatgacacttataccaagaaacaagttctgagaatggagcacctagttttgaaa
gtccttgcttttgacttagctgcaccaacaataaatcagtttcttacccagtactttctg
caccagcagtctgcaaactgcaaagttgaaagtttagcaatgtttttgggagagttaagt
ttgatagatgctgacccatatctaaagtatttgccatcagttatcgccgcagcagccttt
catttagcactctacactgtcacgggacaaagctggcctgaatcattagtacaaaagact
ggatatacgctggaaactctaaagccttgtctcacggaccttcaccagacctacctcaga
gctccgcggcatgcacaacagtcaataagagaaaagtacaaaaactcaaagtatcacggt
gtttctctcctcaacccaccagagacactaaatgtgtaa

DBGET integrated database retrieval system