KEGG   Physeter catodon (sperm whale): 102973751
Entry
102973751         CDS       T06011                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04640  Hematopoietic cell lineage
pcad04916  Melanogenesis
pcad05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102973751 (KITLG)
   04014 Ras signaling pathway
    102973751 (KITLG)
   04015 Rap1 signaling pathway
    102973751 (KITLG)
   04072 Phospholipase D signaling pathway
    102973751 (KITLG)
   04151 PI3K-Akt signaling pathway
    102973751 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102973751 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    102973751 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102973751 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcad04052]
    102973751 (KITLG)
Cytokines and growth factors [BR:pcad04052]
 Growth factors
  Growth factors (RTK binding)
   102973751 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 102973751
NCBI-ProteinID: XP_007114572
UniProt: A0A2Y9F3Y8
LinkDB
Position
6
AA seq 274 aa
MKKTQTWIITCIYLQLFLLNPLVKTQGICRNRVTDDVKDVTKLVANLPKDYKITLKYVPG
MDVLPSHCWISEMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVKKSPKSPEPRLFTPEKFFGIFNKSIDAFKDLKMVASKTSECVMSSTSSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNPIEDSNLQWAAVALPAFFSLVIGFAFGALYWKK
KQPNLTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgttcctacttaat
cctctcgtcaaaactcaagggatctgcaggaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataagataaccctcaaatatgtccccggg
atggacgttttgcctagtcattgttggataagcgagatggtggaacaattgtcagtcagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattactctatc
atagacaaacttgtgaaaatagtcgatgaccttgtggagtgcatggaagaacactcattt
gagaatgtaaaaaaatcacctaagagcccagaacctaggctgtttactcctgaaaaattc
tttggaatttttaataaatccatcgatgccttcaaagacttgaagatggtggcttctaaa
actagtgaatgtgtgatgtcttcaacatcaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagttcccttaggaatgacagcagtagc
agtaataggaaggcctcaaatcccattgaagactccaacctacaatgggcagccgtagca
ttgccagcattcttttctcttgtaattgggtttgcttttggagccttatactggaagaag
aaacaaccaaatcttacaagggcagttgaaaatatacagattaatgaagaggataatgag
ataagtatgttgcaagaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system