KEGG   Physeter catodon (sperm whale): 102974053
Entry
102974053         CDS       T06011                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04310  Wnt signaling pathway
pcad04390  Hippo signaling pathway
pcad04520  Adherens junction
pcad04916  Melanogenesis
pcad04934  Cushing syndrome
pcad05132  Salmonella infection
pcad05165  Human papillomavirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05213  Endometrial cancer
pcad05215  Prostate cancer
pcad05216  Thyroid cancer
pcad05217  Basal cell carcinoma
pcad05221  Acute myeloid leukemia
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102974053 (TCF7L1)
   04390 Hippo signaling pathway
    102974053 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102974053 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102974053 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102974053 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102974053 (TCF7L1)
   05225 Hepatocellular carcinoma
    102974053 (TCF7L1)
   05226 Gastric cancer
    102974053 (TCF7L1)
   05216 Thyroid cancer
    102974053 (TCF7L1)
   05221 Acute myeloid leukemia
    102974053 (TCF7L1)
   05217 Basal cell carcinoma
    102974053 (TCF7L1)
   05215 Prostate cancer
    102974053 (TCF7L1)
   05213 Endometrial cancer
    102974053 (TCF7L1)
   05224 Breast cancer
    102974053 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102974053 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102974053 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102974053 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102974053 (TCF7L1)
   05165 Human papillomavirus infection
    102974053 (TCF7L1)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    102974053 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 NINJA_B
Other DBs
NCBI-GeneID: 102974053
NCBI-ProteinID: XP_023985623
UniProt: A0A2Y9T5M9
LinkDB
Position
12
AA seq 586 aa
MPQLGGGGGGGGGAGGGGSGAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRDL
DEVKSSLVNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGPPYPGY
PFLMIPDLSSPYLPNGPLSPGGARTYLQMKWPLLDVPTSATVKDTRSPSPAHLSNKVPVV
QHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGVPRPPHPSELSPYYPLSPGAVG
QIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPT
SGIPHPAIVSPIVKQEPAPPSLSPAVIAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRA
KVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKK
KKRKREKQLSQTQSQQQVQEADGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPATP
STALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAATSSGQMGSQPPVL
SRPLPLGSVPTALLTSPPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgccccagctcggcggcggcggcggcggcgggggaggcgccggcggcggcggctcgggc
gccggggcggccggcggaggggacgacctcggggccaacgacgagctgatccccttccag
gacgaggggggtgaggagcaggagccgagcagcgacagcgcctcggcgcagcgggacctg
gacgaagtcaagtcgtccctggtcaacgagtcggagaaccagagcagcagctcggactcg
gaggcggagaggcgtccgcagcccgcccgggacgctttccagaagccgcgggactatttc
gccgaagtgagaaggccccaggacggcgcgttctttaagggtcccccctaccctgggtac
ccgttcctgatgataccggacctgagcagcccgtacctccccaacggacccctgtctccg
ggaggagcgcgcacgtacctgcagatgaaatggcccctcctcgatgtccccaccagcgcc
acggtcaaggataccaggtcaccatccccagcacacttgtctaataaagttcctgttgtt
cagcacccgcaccacatgcatccattgacgcccctcatcacctacagcaacgaccacttc
tcccctggctcccctcccacacacctctccccagagatcgatccaaagacaggagtcccc
cggccccctcacccgtctgagctgtctccgtattacccactgtctcccggagctgtcggg
caaatcccccatcccctcggctggctcgtcccacagcaaggacagcccatgtactccctt
cctcccggcggcttccggcacccctaccccgccctcgccatgaatgcctcaatgtccagc
ctggtttccagtcggttctcccctcacatggtggctccggcccatcctggtctgcccacc
tcagggatcccccaccccgccatcgtctcccccatcgtcaagcaggaaccggcgcccccc
agcctgagcccggccgtgatcgcgaaatcacctgtcacagtgaaaaaagaggaagaaaag
aaaccccacgtgaagaagcctcttaatgccttcatgttatatatgaaggagatgagggcc
aaggtggtggccgagtgtaccctgaaggaaagtgcagccattaaccagatcctggggaga
aagtggcacaacctgtcccgggaagaacaggccaagtactacgaactggcccggaaggag
cggcagcttcactcgcagctctacccgacctggtcagcccgggacaactacggtaagaaa
aagaagaggaagcgagaaaagcagctgtcccagacccagtcccagcagcaagtccaggag
gcagacggtgctctggcctccaaaagcaagaagccatgtgtccagtacctgccccctgag
aagccctgtgacagccctgcctcctcccacggcagcatgctggactcgccggccacgccc
tccacggccttggcctccccggctgccccggccgccacccactcggagcaagcccagccc
ctctccctcaccaccaagccagagacccgggcccagctggctctccactcggctgccttc
ctgtcagcgaaggctgccgccacctcctctggccagatgggcagccagccccccgtcctg
tcccggcccctccccctggggtccgtgcccacagctctgctgacgtcccccccttccttc
ccagccacgctgcatgcccaccaggccctccccgtgctccaggcccagcctctttccttg
gtcaccaagtctgcccactaa

KEGG   Physeter catodon (sperm whale): 102987858
Entry
102987858         CDS       T06011                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04310  Wnt signaling pathway
pcad04390  Hippo signaling pathway
pcad04520  Adherens junction
pcad04916  Melanogenesis
pcad04934  Cushing syndrome
pcad05132  Salmonella infection
pcad05165  Human papillomavirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05213  Endometrial cancer
pcad05215  Prostate cancer
pcad05216  Thyroid cancer
pcad05217  Basal cell carcinoma
pcad05221  Acute myeloid leukemia
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102987858 (TCF7L2)
   04390 Hippo signaling pathway
    102987858 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102987858 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102987858 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102987858 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102987858 (TCF7L2)
   05225 Hepatocellular carcinoma
    102987858 (TCF7L2)
   05226 Gastric cancer
    102987858 (TCF7L2)
   05216 Thyroid cancer
    102987858 (TCF7L2)
   05221 Acute myeloid leukemia
    102987858 (TCF7L2)
   05217 Basal cell carcinoma
    102987858 (TCF7L2)
   05215 Prostate cancer
    102987858 (TCF7L2)
   05213 Endometrial cancer
    102987858 (TCF7L2)
   05224 Breast cancer
    102987858 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102987858 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102987858 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102987858 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102987858 (TCF7L2)
   05165 Human papillomavirus infection
    102987858 (TCF7L2)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    102987858 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 102987858
NCBI-ProteinID: XP_023977082
UniProt: A0A2Y9SI93
LinkDB
Position
20
AA seq 674 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAIQYLQMKWPLLDVQAGTLQSRQALKDARSPSP
AHIVQCPLPCCTQGHDCQHFYPPSDFTVSTQVFRDMKRSHSLQKVGEPWCLESNKVPVVQ
HPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQ
IPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSSFLSSRFPPHMVPPHHTLHTT
GIPHPAIVTPTVKQESSQSDVGSLHSAKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAK
VVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKK
KRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCV
RYIQGEGSCLSPPSSDGSLLDSPPSSPNLLGSPPQDAKSQTEQTQPLSLSLKPDPLAHLP
MMSPPPALLLAEAAHGKAPALCANGALELPPAIPPSPLAQPSTSSLHSHGSLAGTQPQPQ
PQPQPLSLVTKSLE
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgagcaagaggagaaaagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccctttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcagtccgggagcacacattactctgcgtac
aaaacgattgaacaccagattgcaattcagtatcttcagatgaaatggccactgcttgat
gtccaggcggggaccctccagagcagacaagccctcaaggatgcccgttctccgtcgccg
gcacacattgttcagtgccccctcccttgctgcactcagggacatgactgtcagcacttc
taccccccctcagacttcactgtcagcactcaagtcttcagggacatgaaaaggagccac
tccttacaaaaggttggggagccctggtgtttggagtcgaacaaagtgccggttgtgcaa
caccctcaccatgtccaccctctcacgcctcttatcacatacagcaatgaacacttcacg
ccgggaaacccacctccacacttaccagctgacgtagaccccaaaacaggaatcccacgg
cctccgcaccctccagatatatctccgtattacccactatcgcccggcactgtaggacaa
atcccccatccgctaggatggttagtaccacagcaaggtcagccagtgtaccccatcacg
acaggaggattccgtcacccctaccccacagctctgactgtcaacgcttccatgtccagc
tttctgtcttctaggttccctccccatatggtcccaccacatcatactctacacacgacc
ggcattccccacccggccatagtcacaccgacagtcaaacaggaatcctcccagagtgac
gtcggctcactccacagcgcaaagcatcaggactccaaaaaggaagaagaaaagaagaag
ccccacataaagaaacctcttaacgcattcatgttgtatatgaaggaaatgagagcaaag
gttgtagccgagtgcacattgaaagaaagtgcagccatcaaccagatcctgggccgaagg
tggcacgcactgtccagagaagagcaagcaaaatactacgagctggcccggaaggagcga
cagcttcacatgcagctgtaccctggctggtccgcacgggataactatgggaagaagaag
aagaggaaaagggacaagcagcccggggagaccaatgaacacagcgaatgtttcctaaat
ccttgcctttcacttcctccgattacagacctgagcgctcctaagaaatgccgagcgcgc
tttggccttgatcaacagaataactggtgcggcccttgcaggagaaaaaaaaagtgcgtt
cgctacatacaaggtgaaggcagctgcctcagtccaccctcttcagatggaagcttacta
gactcgcctccttcctcccccaacctgctaggctcccctccccaagacgccaagtcacag
actgagcagacccagcctctctcgctgtccctgaagcccgaccccctggcccacctgccc
atgatgtctccgccgcccgccctcctgcttgccgaggccgcccacggcaaggcccccgcc
ctctgtgccaacggggccctggagctgcctcccgccatccctccctcacctctggcgcag
ccgtcgacatcttccttacattcccacggctctctggccgggacgcagccgcagccgcag
ccgcagccgcagccgctctccctcgtcaccaagtctttagaatag

KEGG   Physeter catodon (sperm whale): 102992878
Entry
102992878         CDS       T06011                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 isoform X3
  KO
K02620  transcription factor 7
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04310  Wnt signaling pathway
pcad04390  Hippo signaling pathway
pcad04520  Adherens junction
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04916  Melanogenesis
pcad04934  Cushing syndrome
pcad05132  Salmonella infection
pcad05165  Human papillomavirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05213  Endometrial cancer
pcad05215  Prostate cancer
pcad05216  Thyroid cancer
pcad05217  Basal cell carcinoma
pcad05221  Acute myeloid leukemia
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102992878 (TCF7)
   04390 Hippo signaling pathway
    102992878 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102992878 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    102992878 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102992878 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102992878 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102992878 (TCF7)
   05225 Hepatocellular carcinoma
    102992878 (TCF7)
   05226 Gastric cancer
    102992878 (TCF7)
   05216 Thyroid cancer
    102992878 (TCF7)
   05221 Acute myeloid leukemia
    102992878 (TCF7)
   05217 Basal cell carcinoma
    102992878 (TCF7)
   05215 Prostate cancer
    102992878 (TCF7)
   05213 Endometrial cancer
    102992878 (TCF7)
   05224 Breast cancer
    102992878 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102992878 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102992878 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102992878 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102992878 (TCF7)
   05165 Human papillomavirus infection
    102992878 (TCF7)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    102992878 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 102992878
NCBI-ProteinID: XP_023980077
UniProt: A0A2Y9SRL8
LinkDB
Position
8
AA seq 388 aa
MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE
GAAGDAGVPGAGAGARGEAEVGAEALGREHTSQRLFPDKLPESLEDGLKAPECASGMYKD
TVYSAFNLLMHYPPPSGAGQHPQPQPSLHNKASQPSHGVPQLSPLYDHFSSPHPTPAPAD
ISQKQGVHRPLQTPDLSGFYSLTSGTMGQLPHTVSWFTHPPLMLGSGVPGHPAAIPHPAI
VPPSGKQELQPYDRSLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKES
AAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQES
NTGGKRNAFGTYPEKAAAPAPFLPMTVL
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgcctcagctggactcgggcgggggcggcgcgggcggcggcgacgacctcggcgcgccc
gacgagctgctggccttccaggacgagggcgaggagcaggacgacaagagccgcgacagc
gccgcgggccccgagcgcgacctggccgagctcaagtcgtcgctcgtcaatgagtccgag
ggcgcggccggcgacgcgggggtcccgggggcgggcgccggtgcccgcggcgaggccgag
gtcggggccgaggctctcgggcgggaacacacttcgcagagacttttccccgacaaactt
ccagagtctctggaagacggcctgaaggccccggagtgcgccagcggcatgtacaaagac
accgtctactccgccttcaatctgctcatgcactacccacccccctcgggagcagggcag
cacccccagccgcagccctcgctgcacaacaaggccagtcagccttcccacggcgtcccc
caactctctcctctctatgaccatttcagcagcccacaccccacacctgctccagccgac
atcagccagaagcaaggagttcacaggcctctgcagacccctgacctctctggcttctac
tctctgacctcaggcaccatgggacagctcccgcacactgtgagctggttcacccatcca
cccctgatgctaggttccggtgtacctggtcaccccgcagccatcccccacccagccatt
gtgcccccttcagggaagcaggagctgcagccctatgaccgcagcctgaagacgcaggca
gaatccaaggcagagaaggaagccaagaagccaaccatcaagaagcctctcaacgccttc
atgctgtacatgaaggagatgagagcaaaggtcattgcagaatgcacactcaaggagagc
gctgccatcaaccagatcctgggccgtaggtggcacgcactgtcccgggaagagcaggcc
aagtattatgagctggcccgcaaggagaggcagctgcacatgcagctctacccaggctgg
tcggcgcgggacaactacgggaagaagaagaggcggtcacgggaaaagcaccaagaatcc
aacacaggaggaaaaagaaatgcattcggtacttacccggagaaggccgctgccccagcc
ccattccttccgatgacagtgctctag

KEGG   Physeter catodon (sperm whale): 102996605
Entry
102996605         CDS       T06011                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04310  Wnt signaling pathway
pcad04390  Hippo signaling pathway
pcad04520  Adherens junction
pcad04916  Melanogenesis
pcad04934  Cushing syndrome
pcad05132  Salmonella infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05213  Endometrial cancer
pcad05215  Prostate cancer
pcad05216  Thyroid cancer
pcad05217  Basal cell carcinoma
pcad05221  Acute myeloid leukemia
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102996605 (LEF1)
   04390 Hippo signaling pathway
    102996605 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102996605 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102996605 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102996605 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102996605 (LEF1)
   05225 Hepatocellular carcinoma
    102996605 (LEF1)
   05226 Gastric cancer
    102996605 (LEF1)
   05216 Thyroid cancer
    102996605 (LEF1)
   05221 Acute myeloid leukemia
    102996605 (LEF1)
   05217 Basal cell carcinoma
    102996605 (LEF1)
   05215 Prostate cancer
    102996605 (LEF1)
   05213 Endometrial cancer
    102996605 (LEF1)
   05224 Breast cancer
    102996605 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102996605 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102996605 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102996605 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102996605 (LEF1)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    102996605 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 102996605
NCBI-ProteinID: XP_023975237
UniProt: A0A2Y9SD09
LinkDB
Position
7
AA seq 399 aa
MPQLSGAGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQDSYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVSS
KQGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPVTGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgccccaactctccggggcaggcggcggcggtgggggggacccggaactctgcgccacg
gacgagatgatccccttcaaagacgagggcgatccccagaaggagaagattttcgccgag
atcagtcaccctgaagaggaaggtgacttagccgacatcaagtcttccttggttaatgaa
tccgaaatcatcccggcgagcaacggacacgaggtggccagacaagcacaaacctctcag
gactcctaccacgacaaggccagagaacaccctgatgacggaaagcatccagatggagga
ctctacaacaagggaccctcttactcgagttattccgggtacataatgatgccaaatatg
aataatgacccatacatgtcaaatggatctctttctccacccatcccgagaacatcaaat
aaagtgcccgtggtgcagccatcccacgcagtccatcctctcacccccctcataacttac
agcgacgagcacttttctccaggatcacacccgtcacacatcccatcggatgtcagctcc
aaacaaggcatgtccagacatcctccagctcccgagatccctaccttttatcccctgtct
ccgggtggtgttggacagattaccccacctcttggctggcaaggtcagcctgtatatccc
gtcacgggaggcttcaggcaaccctacccatcctccctgtcagtcgacacttccatgtcc
aggttttctcatcatatgattcctggtcctcctggcccccacacaactggcatcccacat
ccagctatcgtaacgcctcaggtcaaacaggaacacccgcacactgacagcgacctaatg
cacgtgaagcctcagcatgaacagagaaaggagcaggagccaaaaagacctcacattaag
aagcctctgaatgcttttatgttatacatgaaagaaatgagagcgaatgtcgtagctgag
tgtactctaaaggaaagtgcagctatcaaccagattctaggcagaaggtggcatgccctc
tctcgtgaagagcaggctaaatattatgaattagcgcggaaggaaagacagctacatatg
cagctctatccaggctggtctgcaagagacaattatggtaagaaaaagaagaggaagaga
gagaaactacaggaatctacatcaggtacaggtccaagaatgacagctgcctacatctga

DBGET integrated database retrieval system