KEGG   Physeter catodon (sperm whale): 102974198
Entry
102974198         CDS       T06011                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65 isoform X2
  KO
K04735  transcription factor p65
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01523  Antifolate resistance
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04064  NF-kappa B signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04137  Mitophagy - animal
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04211  Longevity regulating pathway
pcad04218  Cellular senescence
pcad04380  Osteoclast differentiation
pcad04620  Toll-like receptor signaling pathway
pcad04621  NOD-like receptor signaling pathway
pcad04622  RIG-I-like receptor signaling pathway
pcad04623  Cytosolic DNA-sensing pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04657  IL-17 signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04668  TNF signaling pathway
pcad04722  Neurotrophin signaling pathway
pcad04917  Prolactin signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad04926  Relaxin signaling pathway
pcad04931  Insulin resistance
pcad04932  Non-alcoholic fatty liver disease
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad05010  Alzheimer disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05030  Cocaine addiction
pcad05132  Salmonella infection
pcad05133  Pertussis
pcad05134  Legionellosis
pcad05135  Yersinia infection
pcad05140  Leishmaniasis
pcad05142  Chagas disease
pcad05145  Toxoplasmosis
pcad05146  Amoebiasis
pcad05152  Tuberculosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05203  Viral carcinogenesis
pcad05212  Pancreatic cancer
pcad05215  Prostate cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05222  Small cell lung cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05321  Inflammatory bowel disease
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102974198 (RELA)
   04014 Ras signaling pathway
    102974198 (RELA)
   04064 NF-kappa B signaling pathway
    102974198 (RELA)
   04668 TNF signaling pathway
    102974198 (RELA)
   04066 HIF-1 signaling pathway
    102974198 (RELA)
   04071 Sphingolipid signaling pathway
    102974198 (RELA)
   04024 cAMP signaling pathway
    102974198 (RELA)
   04151 PI3K-Akt signaling pathway
    102974198 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102974198 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    102974198 (RELA)
   04218 Cellular senescence
    102974198 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102974198 (RELA)
   04621 NOD-like receptor signaling pathway
    102974198 (RELA)
   04622 RIG-I-like receptor signaling pathway
    102974198 (RELA)
   04623 Cytosolic DNA-sensing pathway
    102974198 (RELA)
   04625 C-type lectin receptor signaling pathway
    102974198 (RELA)
   04660 T cell receptor signaling pathway
    102974198 (RELA)
   04658 Th1 and Th2 cell differentiation
    102974198 (RELA)
   04659 Th17 cell differentiation
    102974198 (RELA)
   04657 IL-17 signaling pathway
    102974198 (RELA)
   04662 B cell receptor signaling pathway
    102974198 (RELA)
   04062 Chemokine signaling pathway
    102974198 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102974198 (RELA)
   04917 Prolactin signaling pathway
    102974198 (RELA)
   04926 Relaxin signaling pathway
    102974198 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102974198 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102974198 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    102974198 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102974198 (RELA)
   05202 Transcriptional misregulation in cancer
    102974198 (RELA)
   05203 Viral carcinogenesis
    102974198 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102974198 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102974198 (RELA)
   05221 Acute myeloid leukemia
    102974198 (RELA)
   05220 Chronic myeloid leukemia
    102974198 (RELA)
   05215 Prostate cancer
    102974198 (RELA)
   05222 Small cell lung cancer
    102974198 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102974198 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102974198 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    102974198 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    102974198 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102974198 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102974198 (RELA)
   04931 Insulin resistance
    102974198 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102974198 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102974198 (RELA)
   05135 Yersinia infection
    102974198 (RELA)
   05133 Pertussis
    102974198 (RELA)
   05134 Legionellosis
    102974198 (RELA)
   05152 Tuberculosis
    102974198 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102974198 (RELA)
   05170 Human immunodeficiency virus 1 infection
    102974198 (RELA)
   05162 Measles
    102974198 (RELA)
   05164 Influenza A
    102974198 (RELA)
   05161 Hepatitis B
    102974198 (RELA)
   05160 Hepatitis C
    102974198 (RELA)
   05168 Herpes simplex virus 1 infection
    102974198 (RELA)
   05163 Human cytomegalovirus infection
    102974198 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102974198 (RELA)
   05169 Epstein-Barr virus infection
    102974198 (RELA)
   05165 Human papillomavirus infection
    102974198 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102974198 (RELA)
   05145 Toxoplasmosis
    102974198 (RELA)
   05140 Leishmaniasis
    102974198 (RELA)
   05142 Chagas disease
    102974198 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102974198 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102974198 (RELA)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102974198 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 102974198
NCBI-ProteinID: XP_007128247
UniProt: A0A2Y9FPV8
LinkDB
Position
Unknown
AA seq 562 aa
MWACADPCLPLLSDLFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGE
RSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRC
IHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPVEEQRGDYDLNAVRLCFQVTVRDPA
GRPRRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFT
GPGWEARGSFSQADVHRQVAIVFRTPPYADSSLQAPVRVSMQLRRPSDRELSEPMEFQYL
PDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTDHRPPTRRIAVPSRSSASVPKPAPQPY
PFTPSLSTINFEEFSPMVFPSGQIPSQTSALAPAPALVLAQAPAPAPAMASALAQAPAPG
PVLAPGLAQAVTPPAPKTNPAGEGTLTEALLQLQFDADEDLGALLGNSTDPAVFTDLASV
DNSEFQQLLNQGVTMAPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLS
GDEDFSSIADMDFSALLSQISS
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgtgggcttgtgctgacccttgtctccctctcctttcagacctcttccccctcatcttc
cccgcggagccggcccaggcctccggcccctacgtggagatcatcgagcagcccaagcag
cggggcatgcgctttcgctacaagtgtgagggccgctcagctggcagtatcccaggcgag
aggagcacagataccaccaagacccaccccaccatcaagatcaatggctacacagggcca
gggacagtccgcatctccctggtgaccaaggacccccctcaccggcctcacccccatgag
cttgtggggaaagactgccgggatggcttctatgaggctgagctctgcccggaccgctgc
atccacagcttccagaacctggggatccagtgtgtaaagaagcgggacctggagcaggcc
atcagtcagcgcatccagaccaacaacaaccccttccaagttcccgtagaagagcagcgc
ggggactacgacctgaacgccgtgcggctctgcttccaggtgacggtgcgggacccggca
ggcaggccccgacgcttgccgcccgtcctctctcatcccatctttgacaaccgcgccccc
aacactgccgagctcaagatctgccgagtgaatcggaactctgggagctgccttgggggc
gatgagatcttcctgctgtgtgacaaggtgcagaaagaggatatcgaggtgtatttcacg
ggaccaggctgggaggctcgaggctccttttcacaagctgatgtgcaccggcaagtggcc
atcgtgttccggacgcccccctacgcggactccagcctgcaggcccccgtgcgcgtctcc
atgcagctgcggcggccttctgatcgggagctcagcgagcccatggaattccagtacttg
ccagacacagatgatcgtcaccggattgaagagaaacgcaaaaggacatatgagaccttt
aagagcatcatgaagaagagccctttcaacggacccaccgaccaccggcctccgacccgg
cgcatcgctgtgccttcccgcagctcagcttccgtccccaagccagctccccagccctat
ccctttacaccatctctcagcaccatcaactttgaggagttctcccccatggtctttcct
tctgggcagatcccaagccagacctcggccttggcaccagcccctgccctagtcctggcc
caggccccagcccctgccccagccatggcatcggccctggcccaggccccagcccctggc
ccagtcctagccccaggccttgctcaggctgtgaccccacctgcccccaagaccaacccg
gctggggaagggacactgacagaggccctgctgcagctgcagttcgatgctgatgaagac
ctgggggccctgctcggcaatagcacagatccagccgtgttcacagacctggcatccgtc
gacaactctgagtttcagcagctcctgaaccagggtgtaaccatggccccccatacggca
gagcccatgctgatggagtaccctgaggctataactcgtctggtgacggggtcccagagg
ccccctgacccagctcccactcccctgggagcctctggcctcaccaacggcctcctctca
ggggatgaagacttctcctccattgcggacatggacttctcagcccttctgagtcagatc
agctcctaa

DBGET integrated database retrieval system