KEGG   Physeter catodon (sperm whale): 102974256
Entry
102974256         CDS       T06011                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03420  Nucleotide excision repair
pcad04115  p53 signaling pathway
pcad04120  Ubiquitin mediated proteolysis
pcad05161  Hepatitis B
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05216  Thyroid cancer
pcad05217  Basal cell carcinoma
pcad05218  Melanoma
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102974256 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    102974256 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102974256 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102974256 (DDB2)
   05202 Transcriptional misregulation in cancer
    102974256 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102974256 (DDB2)
   05212 Pancreatic cancer
    102974256 (DDB2)
   05225 Hepatocellular carcinoma
    102974256 (DDB2)
   05226 Gastric cancer
    102974256 (DDB2)
   05214 Glioma
    102974256 (DDB2)
   05216 Thyroid cancer
    102974256 (DDB2)
   05220 Chronic myeloid leukemia
    102974256 (DDB2)
   05217 Basal cell carcinoma
    102974256 (DDB2)
   05218 Melanoma
    102974256 (DDB2)
   05213 Endometrial cancer
    102974256 (DDB2)
   05224 Breast cancer
    102974256 (DDB2)
   05222 Small cell lung cancer
    102974256 (DDB2)
   05223 Non-small cell lung cancer
    102974256 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102974256 (DDB2)
   05169 Epstein-Barr virus infection
    102974256 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pcad04121]
    102974256 (DDB2)
   03400 DNA repair and recombination proteins [BR:pcad03400]
    102974256 (DDB2)
Ubiquitin system [BR:pcad04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     102974256 (DDB2)
DNA repair and recombination proteins [BR:pcad03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      102974256 (DDB2)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 102974256
NCBI-ProteinID: XP_007121294
UniProt: A0A2Y9FEW6
LinkDB
Position
Unknown
AA seq 457 aa
MAPRKRPETQKTPEVVVRPKSKRNRSPRELEPEAKKLCLKGPGPSRRFDSGCLWAGLASL
RVPPPCSIIRALHQHKLGTAAWPSLQQGLQQSFLNSLASYRIFQKAAPFDRRATSLAWHP
THPSTLAVGSKGGDILVWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFFTSSMEGTT
RLQDFKGNTLRVFASSGTCNFWFCSLDVSVKSRVVVTGDNVGNVILLNMDGRELWNLRMH
KKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKSSFLYSLLHRHPVNAAHFSPDGA
QLLTTDQKSEIRVYSASQWDCPPSLIPHPHRHFQHLTPIKATWHPRYNLIVVGRYPDPNF
KSCTSHELRTIDVFDGSSGKMMYQLYDPESSGIMSVRLGPSNNNGRKQGFTLPYWIKNDQ
KLILMCPSPSTFIPSSCLSPCLCSSMSSILWGTHWPL
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggctcccaggaaacgcccagaaacccagaagacccccgaggtggttgtgcgccccaag
agcaagaggaacagaagcccccgggagctggagcccgaggccaagaagctctgtttgaag
ggccccggtcctagcagaagatttgactcaggctgcctttgggcggggttggctagcctg
cgggtcccgccaccatgcagcatcatcagggccctccaccagcataagctgggcacagct
gcctggccatcactacagcagggtctccagcagtcctttttgaactctctggcttcttac
cggatattccaaaaggctgccccttttgacaggagggccacatccctggcgtggcaccca
actcaccccagcaccctggctgtgggttccaaagggggagatatcttggtctggaacttt
ggcataaaggacaaacccactttcattaaagggattggagctggagggagcatcactggg
ctgaagtttaaccctctcaataccaaccagtttttcacctcctcaatggagggaacaact
aggctgcaagactttaaaggcaacactctccgagtttttgccagctcaggcacctgcaac
ttctggttttgcagcctggatgtgtctgtcaaaagccgagtggtggtcacaggagataac
gtggggaacgtgatcctgctgaacatggacggcagggagctttggaatctgagaatgcac
aaaaagaaagtgacccacgtggccctgaacccgtgctgtgattggttcctggccacggcc
tctgtagatcaaacagtgaaaatctgggacctgcgccaggttagagggaaatccagcttc
ctctactcgctgctgcacaggcatcccgtcaacgcagctcatttcagtcccgacggtgcc
cagctcctgaccactgaccagaagagtgagatccgggtttactctgcctcccagtgggac
tgccccccaagccttatcccacaccctcatcgccacttccagcacctgacacccatcaag
gcaacctggcatcctcggtacaacctcattgtcgtgggccgatacccagatcctaatttc
aaaagttgtacctcccatgaattaaggacaatcgatgtgtttgatggaagctcaggaaag
atgatgtatcagctgtatgacccagaatcttctggtatcatgtcggtgaggcttgggccc
tcaaataataatgggaggaagcagggattcaccttaccttattggatcaaaaacgaccag
aaattaatcctcatgtgcccttctcccagtaccttcattccctcctcatgcttatcccct
tgtctctgcagctcaatgagttcaatcctatgggggacacactggcctctgtga

DBGET integrated database retrieval system