KEGG   Physeter catodon (sperm whale): 102974323
Entry
102974323         CDS       T06011                                 

Gene name
PPP2R3C
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma isoform X1
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03015  mRNA surveillance pathway
pcad04071  Sphingolipid signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04728  Dopaminergic synapse
pcad05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102974323 (PPP2R3C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102974323 (PPP2R3C)
   04151 PI3K-Akt signaling pathway
    102974323 (PPP2R3C)
   04152 AMPK signaling pathway
    102974323 (PPP2R3C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102974323 (PPP2R3C)
  09156 Nervous system
   04728 Dopaminergic synapse
    102974323 (PPP2R3C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102974323 (PPP2R3C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102974323 (PPP2R3C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102974323 (PPP2R3C)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102974323 (PPP2R3C)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     102974323 (PPP2R3C)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     102974323 (PPP2R3C)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     102974323 (PPP2R3C)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_13 EF-hand_1 EF-hand_5 DUF61
Other DBs
NCBI-GeneID: 102974323
NCBI-ProteinID: XP_007112369
UniProt: A0A2Y9EZY1
LinkDB
Position
11
AA seq 453 aa
MDWKEILRRRIATPNTGPNKKKSEQELKDEEMDLFTKYYSEWKEGRKNTNEFYKTIPRFY
YRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINY
ENFLKVGEKAGPKCKQFFAAKVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLY
DVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKI
QDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSR
YGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGY
LNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV
TTILIDLNGFWTYENREALVANDNENSADLDDT
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggactggaaagaaattcttcgccggcggatagcgacgcccaacaccggtccaaacaaa
aaaaaaagtgaacaagaattaaaagatgaagaaatggatttatttaccaagtattactca
gaatggaaagaaggtagaaaaaacacaaatgaattctataagaccattccccggttttat
tataggctgccagctgaagatgaagtcttactacagaaattaagagaagaatccagagcc
gtctttctgcaaaggaaaagcagggaactgttagataatgaagaattacagaacttatgg
tttttgctggacaagcaccagacaccacccatgattggagaggaagcaatgattaattat
gaaaattttttaaaggttggtgaaaaagctggaccaaagtgcaagcaatttttcgcagca
aaagtctttgctaaactccttcatacagattcttatggaagaatttccatcatgcagttc
tttaattatgtcatgagaaaagtttggcttcatcagacaagaataggcctcagtttatat
gatgttgctggacaagggtatcttcgggaatctgatttagaaaactacatattggaactt
atccctactttgccacaattagatgggctggaaaaatctttttactccttttatgtttgt
acagcagttaggaagttcttcttctttttagaccctctaagaacagggaagataaaaatt
caagatattttagcatgcagcttcctagatgatttattggagttaagggatgaggaactg
tccaaggagagtcaagaaacaaattggttttctgctccttctgccttacgggtgtatggc
caatatttgaatcttgataaggatcacaatggcatgctcagtaaagaagaactctcccgc
tatggaacagcaaccatgaccaatgtcttcttagaccgtgttttccaggagtgtctcact
tatgatggagaaatggactataagacctacctggattttgttcttgcattagaaaaccga
aaagaacctgcagctctgcaatatattttcaaattgcttgacattgagaacaaagggtat
ctgaatgtgttttcccttaattatttctttagggccatacaagaactaatgaaaatccat
ggacaggatcctgtttcatttcaagacgtcaaggatgaaatctttgacatggtaaaacca
aaggatcctttgaaaatctctcttcaggatttaatcaacagtaatcaaggagacacagtc
accaccattctaattgatctgaatggcttctggacttacgagaatagagaagcccttgtt
gcaaatgataatgaaaactccgcagaccttgatgatacatga

KEGG   Physeter catodon (sperm whale): 102974912
Entry
102974912         CDS       T06011                                 

Gene name
PPP2CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03015  mRNA surveillance pathway
pcad04071  Sphingolipid signaling pathway
pcad04114  Oocyte meiosis
pcad04136  Autophagy - other
pcad04140  Autophagy - animal
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04350  TGF-beta signaling pathway
pcad04390  Hippo signaling pathway
pcad04530  Tight junction
pcad04728  Dopaminergic synapse
pcad04730  Long-term depression
pcad05142  Chagas disease
pcad05160  Hepatitis C
pcad05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102974912 (PPP2CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102974912 (PPP2CB)
   04390 Hippo signaling pathway
    102974912 (PPP2CB)
   04071 Sphingolipid signaling pathway
    102974912 (PPP2CB)
   04151 PI3K-Akt signaling pathway
    102974912 (PPP2CB)
   04152 AMPK signaling pathway
    102974912 (PPP2CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102974912 (PPP2CB)
   04136 Autophagy - other
    102974912 (PPP2CB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102974912 (PPP2CB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102974912 (PPP2CB)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102974912 (PPP2CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    102974912 (PPP2CB)
   04730 Long-term depression
    102974912 (PPP2CB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    102974912 (PPP2CB)
   05165 Human papillomavirus infection
    102974912 (PPP2CB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102974912 (PPP2CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102974912 (PPP2CB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102974912 (PPP2CB)
   04131 Membrane trafficking [BR:pcad04131]
    102974912 (PPP2CB)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102974912 (PPP2CB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102974912 (PPP2CB)
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102974912 (PPP2CB)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     102974912 (PPP2CB)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     102974912 (PPP2CB)
Membrane trafficking [BR:pcad04131]
 Autophagy
  Other autophagy associated proteins
   Others
    102974912 (PPP2CB)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     102974912 (PPP2CB)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102974912 (PPP2CB)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N
Other DBs
NCBI-GeneID: 102974912
NCBI-ProteinID: XP_023987176
UniProt: A0A2Y9T8C8
LinkDB
Position
20
AA seq 309 aa
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgacaaggcgttcaccaaggagctggaccagtgggtcgagcagctgaacgagtgt
aaacaactgaacgagaaccaggtgcggacgctgtgcgaaaaggctaaggaaattttaaca
aaagaatcaaatgtgcaagaggtccgttgtcctgttaccgtctgtggagatgtgcatggt
caattccatgaccttatggaactctttagaatcggtgggaagtcaccagatacaaactat
ctattcatgggtgactatgtagacagaggttattattctgtggagactgtgactcttctt
gtggcattaaaggtgcgttatccagaacgtattacaatattgagaggaaaccacgaaagc
cgacaaattacccaagtatatggcttttatgatgaatgtctgcgaaagtatgggaatgcc
aatgtttggaaatacttcacagatctgtttgactatctgccacttacagctttagtagat
ggacagatattctgcctccatggtggcctctccccatccatagatacactggatcatata
agagccctggatcgtttacaagaagttccacatgagggcccaatgtgtgatctgttatgg
tcagatccagatgatcgtggtgggtggggtatttcaccacgaggcgctggctacacattt
ggacaagatatttctgaaacatttaaccatgccaatggtctcacactggtttctcgtgct
caccaacttgtaatggagggatacaattggtgtcacgatcggaatgtggttaccattttc
agtgcaccgaattactgttatcgttgtgggaaccaggctgctatcatggaattagatgac
actttgaagtattccttccttcagtttgacccagcacctcgtcgtggagagcctcatgtg
acccggcgcacgccagactactttctgtaa

KEGG   Physeter catodon (sperm whale): 102976080
Entry
102976080         CDS       T06011                                 

Gene name
PPP2R2D
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03015  mRNA surveillance pathway
pcad04071  Sphingolipid signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04390  Hippo signaling pathway
pcad04530  Tight junction
pcad04728  Dopaminergic synapse
pcad05142  Chagas disease
pcad05160  Hepatitis C
pcad05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102976080 (PPP2R2D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102976080 (PPP2R2D)
   04071 Sphingolipid signaling pathway
    102976080 (PPP2R2D)
   04151 PI3K-Akt signaling pathway
    102976080 (PPP2R2D)
   04152 AMPK signaling pathway
    102976080 (PPP2R2D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102976080 (PPP2R2D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102976080 (PPP2R2D)
  09156 Nervous system
   04728 Dopaminergic synapse
    102976080 (PPP2R2D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    102976080 (PPP2R2D)
   05165 Human papillomavirus infection
    102976080 (PPP2R2D)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102976080 (PPP2R2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102976080 (PPP2R2D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102976080 (PPP2R2D)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102976080 (PPP2R2D)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     102976080 (PPP2R2D)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     102976080 (PPP2R2D)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     102976080 (PPP2R2D)
SSDB
Other DBs
NCBI-GeneID: 102976080
NCBI-ProteinID: XP_023977052
UniProt: A0A2Y9SI59
LinkDB
Position
20
AA seq 453 aa
MAGAGGGGCPAGGNDLQWCFSQVKGAVDEDVAEADVISTVEFSHSGDLLATGDKGGRVVI
FQREQENKSRPHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQSAAHFLLST
NDKTIKLWKISERDKRAEGYNLKDEDGRLRDPFRITALRVPILKPMDLMVEASPRRIFAN
AHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEF
HPHQCNVLVYSSSKGTIRLCDMRSSALCDRHSKFFEEPEDPSSRSFFSEIISSVSDVKFS
HSGRYMMTRDYLSVKVWDLNMESRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSD
SAIMTGSYNNFFRMFDRTTWRDVTLEASRENSKPRASLKPRRVCAGGKRKKDEVSVDSLD
FSKKILHTAWHPAENIIAVAATNNLYIFQDKAN
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcaggagccggaggcggcggctgccctgcgggcggcaacgacttgcagtggtgtttc
tcgcaggtcaagggggccgtggacgaggacgtggctgaagctgatgtcatctcaactgtg
gaatttagtcactctggagatcttcttgcaacaggagacaagggcggcagagtggttatt
tttcagcgggaacaagagaataaaagccgccctcattccaggggggaatataacgtttac
agtacctttcaaagtcacgaaccagagtttgactatttgaagagtctagaaattgaagaa
aaaattaataaaattaggtggttaccgcaacagagtgctgctcattttctgctctccaca
aacgataaaactattaaattatggaaaataagtgaacgggataaaagagcggaaggctat
aacttaaaagacgaagatggacgacttcgagatccatttagaatcacggcactgcgggtc
ccaatattgaagcccatggaccttatggtagaagcaagtccacgacgaatttttgcaaat
gctcacacatatcatataaattccatttcagtaaatagtgatcatgaaacatatctttct
gcagatgacctgagaattaatctatggcatttagaaatcacagatagaagttttaacatc
gtggacatcaagcctgccaacatggaagagctgacggaggtgatcacggcggccgagttc
cacccgcaccagtgtaacgtgctcgtctacagcagcagcaaggggaccatcagactgtgc
gacatgcgctcctccgccctgtgcgaccgacactccaagttttttgaggagccggaagac
cccagcagtaggtccttcttctccgaaataatctcttctgtgtccgatgtgaaattcagc
cacagcggtcggtacatgatgacccgggactacctgtcggtgaaggtgtgggacctcaac
atggagagccggcctgtcgagacccaccaggtccacgagtaccttcgaagcaagctgtgt
tccctgtacgaaaacgactgcatctttgacaagtttgagtgctgctggaacggctccgac
agtgcaatcatgactgggtcctacaacaacttcttcagaatgttcgataggactacatgg
agggatgttacgctggaagcttccagggagaacagcaagcctcgcgccagcttgaagcct
cgcagagtgtgtgcaggtgggaagagaaagaaggacgaggtgagcgtggacagcctggac
ttcagcaagaagattctgcacacagcctggcacccggcggagaacatcattgccgtggct
gccaccaataacctgtacatattccaggacaaggccaactaa

KEGG   Physeter catodon (sperm whale): 102982040
Entry
102982040         CDS       T06011                                 

Gene name
PPP2R2B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03015  mRNA surveillance pathway
pcad04071  Sphingolipid signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04390  Hippo signaling pathway
pcad04530  Tight junction
pcad04728  Dopaminergic synapse
pcad05142  Chagas disease
pcad05160  Hepatitis C
pcad05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102982040 (PPP2R2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102982040 (PPP2R2B)
   04071 Sphingolipid signaling pathway
    102982040 (PPP2R2B)
   04151 PI3K-Akt signaling pathway
    102982040 (PPP2R2B)
   04152 AMPK signaling pathway
    102982040 (PPP2R2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102982040 (PPP2R2B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102982040 (PPP2R2B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102982040 (PPP2R2B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    102982040 (PPP2R2B)
   05165 Human papillomavirus infection
    102982040 (PPP2R2B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102982040 (PPP2R2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102982040 (PPP2R2B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102982040 (PPP2R2B)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102982040 (PPP2R2B)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     102982040 (PPP2R2B)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     102982040 (PPP2R2B)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     102982040 (PPP2R2B)
SSDB
Other DBs
NCBI-GeneID: 102982040
NCBI-ProteinID: XP_023977922
UniProt: A0A2Y9SKJ3
LinkDB
Position
8
AA seq 443 aa
MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQ
VHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKV
SERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSIS
VNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNTFVY
SSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRD
YLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNN
FFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAW
HPSENIIAVAATNNLYIFQDKVN
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggaggaggacattgatacccgcaaaatcaacaacagtttcctgcgcgaccacagctat
gcgaccgaagctgacattatctctacggtagaattcaaccacacgggagaattactagcg
acaggggacaaggggggtcgggttgtaatatttcaacgagagcaggagagtaaaaatcag
gttcatcgtaggggtgaatacaatgtttacagcacattccagagccatgaacccgagttc
gattacctgaagagtttagaaatagaagaaaaaatcaataaaataagatggctccctcag
cagaatgcagcctacttccttctgtctactaatgataaaactgtgaagctgtggaaagtc
agcgagcgtgataagaggccagaaggctacaatctgaaagatgaggagggccggctccgg
gatcctgccaccatcacaaccttgcgggtgcctgtcctgagacccatggacctgatggtg
gaggccaccccgcgaagagtatttgccaacgcacacacatatcacatcaactccatatca
gtcaacagcgactatgaaacctacatgtcagctgatgacctgaggattaacctgtggaac
tttgaaataaccaatcaaagttttaatatcgtcgacatcaagccggccaacatggaggag
ctcacagaggtgatcacagcggccgagttccacccccatcactgcaacaccttcgtgtac
agcagcagcaaagggacaatccggctgtgtgacatgcgggcgtcggccctgtgtgacagg
cacaccaaattttttgaagagccggaagatccaagcaacaggtcgtttttctctgaaatc
atctcttcgatttcagatgtgaagttcagccacagtgggaggtatatcatgaccagagac
tatctgacggtcaaagtttgggatctcaacatggaaaaccgccccatcgagacttaccag
gttcacgactacctccgcagcaagctgtgctccctctacgaaaatgactgcatttttgat
aaatttgaatgtgtgtggaatgggtcagacagtgtcatcatgacgggctcctacaacaac
ttcttcaggatgtttgaccgaaacaccaagcgcgatgttacccttgaggcctcgagggaa
aacagcaaaccccgagctatcctaaaaccgcgcaaagtgtgcgtggggggcaagcggaga
aaagacgagatcagtgttgacagtctggactttagcaaaaagatcttgcatacagcttgg
catccttcagaaaatattatagcagtggcggctacaaataacctatatatattccaggac
aaggttaactag

KEGG   Physeter catodon (sperm whale): 102983421
Entry
102983421         CDS       T06011                                 

Gene name
PPP2R5A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03015  mRNA surveillance pathway
pcad04071  Sphingolipid signaling pathway
pcad04114  Oocyte meiosis
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04728  Dopaminergic synapse
pcad05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102983421 (PPP2R5A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102983421 (PPP2R5A)
   04151 PI3K-Akt signaling pathway
    102983421 (PPP2R5A)
   04152 AMPK signaling pathway
    102983421 (PPP2R5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102983421 (PPP2R5A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102983421 (PPP2R5A)
  09156 Nervous system
   04728 Dopaminergic synapse
    102983421 (PPP2R5A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102983421 (PPP2R5A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102983421 (PPP2R5A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102983421 (PPP2R5A)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102983421 (PPP2R5A)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     102983421 (PPP2R5A)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     102983421 (PPP2R5A)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     102983421 (PPP2R5A)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 102983421
NCBI-ProteinID: XP_023989512
UniProt: A0A2Y9TIQ2
LinkDB
Position
4
AA seq 487 aa
MSSSSPPPAGTASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQSSQPELHPLPQL
KDATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESA
YSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSI
AKRYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYE
TEHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQF
LEKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKC
VSSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFGSLYKISKEHWNPTIVALVYNVL
KTLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSI
LSNTTDE
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgtcgtcgtcgtcgccgccgccggcggggactgccagcgccgccatctcggcctcggag
aaagtggacggcttcacccggaaatcggtgcgcaaggcgcagaggcagaagcgctcgcag
ggctcgtcgcagttccgcagccagagcagccagccggagctgcaccccttgccccagctc
aaagatgccacttcaaatgaacaacaagagcttttctgtcagaagctgcagcagtgttgc
atactgtttgatttcatggactctgtttcagacttgaagagcaaagaaattaaaagagca
acattgaatgaactggttgagtatgtttcaactaatcgtggtgtaattgttgaatcagcg
tattctgatatagtaaaaatgatcagtgctaacatcttccgaactcttcctccaagtgat
aatccagattttgatccagaagaggatgagcccacacttgaggcctcttggcctcacata
caattggtgtatgaattcttcttaaggtttttggagagccctgatttccagcctagcatt
gcaaagcgatacattgatcagaagtttgtacaacagctcctggagctttttgatagtgaa
gatcccagagaacgcgacttcctgaagaccgttctgcatcgaatttatgggaaatttctt
ggattaagagcattcatcagaaaacaaattaacaacattttcctcaggtttatatatgaa
acagagcatttcaatggtgttgctgaactccttgaaatattaggaagtattatcaatggc
tttgcattgccactgaaagcagaacataaacaatttctaatgaaggttcttattcctatg
catactgcaaaaggattagctttgtttcatgctcagctagcctactgtgttgtacagttc
ctggagaaagatacaacactaacagaacctgtgatcagaggattgctgaaattttggcca
aaaacatgcagtcagaaagaggtgatgtttttaggagaaattgaagaaatcttagatgtc
attgaaccaacacaattcaaaaaaattgaagagcccctttttaagcagatatccaagtgt
gtatccagttctcattttcaggttgcagaaagggcgctgtacttctggaacaatgaatat
attcttagtttgattgaggagaatattgataaaattctgccaattatgtttggcagtttg
tacaaaatctccaaagaacactggaatccgaccattgtagcactggtgtacaatgtgctg
aaaaccctcatggagatgaacggcaagctttttgatgatcttactagttcatacaaagct
gaaagacaaagggagaaaaagaaggaattggaacgtgaagaattatggaaaaaattggag
gagctaaagctaaagaaagctctagaaaagcagaacagtgcttacaacatgcacagtatt
ctcagcaatacaactgatgaataa

KEGG   Physeter catodon (sperm whale): 102984521
Entry
102984521         CDS       T06011                                 

Gene name
PPP2R5C
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03015  mRNA surveillance pathway
pcad04071  Sphingolipid signaling pathway
pcad04114  Oocyte meiosis
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04728  Dopaminergic synapse
pcad05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102984521 (PPP2R5C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102984521 (PPP2R5C)
   04151 PI3K-Akt signaling pathway
    102984521 (PPP2R5C)
   04152 AMPK signaling pathway
    102984521 (PPP2R5C)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102984521 (PPP2R5C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102984521 (PPP2R5C)
  09156 Nervous system
   04728 Dopaminergic synapse
    102984521 (PPP2R5C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102984521 (PPP2R5C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102984521 (PPP2R5C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102984521 (PPP2R5C)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102984521 (PPP2R5C)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     102984521 (PPP2R5C)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     102984521 (PPP2R5C)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     102984521 (PPP2R5C)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 102984521
NCBI-ProteinID: XP_023986893
UniProt: A0A2Y9TAX8
LinkDB
Position
11
AA seq 588 aa
MPNKNKKEKESPKAGKSGKSSKEGQDIIESEIPSRKNSLVAAPSAVSSKIKVPAPQPVVK
KDKRQNSSRFSASNNRELQKLPSLKDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWK
EVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPT
LEAAWPHLQKLQRYRIVRVFSLKVTVELRSEVLQTWRSCKHFSVCVPAVRPRPICLTESP
DFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIF
YRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLA
YCVVQFLEKDSTLTEPVVMALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLF
RQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHG
LIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQYAVCSQ
ASTASLPVAVETDGPLLEDVQMLRETVNEEARQSVGRKAVTTMQLRKV
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgccgaataaaaacaagaaggagaaagaatcaccaaaagcagggaaaagtggaaaaagt
tcaaaagaaggacaagacataatagaatcagagattcccagcaggaaaaacagccttgtt
gctgccccgtctgcagtatctagtaaaataaaagtgccagcccctcagcccgtagtgaag
aaagacaaacggcaaaattcttccaggtttagcgccagcaataatagagaacttcaaaaa
ctaccatctttaaaagatgttcctcctgctgatcaagagaagctttttatccagaagtta
cgtcagtgttgtgtcctctttgactttgtttccgatccactaagtgacctaaagtggaag
gaagtaaaacgagctgctttaagtgaaatggtagaatatatcacccataatcggaatgtg
atcacagagcctatttacccagaagtagtccatatgtttgcagttaacatgtttcgaaca
ttaccaccttcctccaaccctacgggagcagaatttgacccagaggaagatgagccaacg
ttagaagcagcctggcctcacctgcagaaactacaaagatacagaattgtccgtgtattt
tcactgaaagtgaccgtggaattgaggtcggaggtcttgcaaacatggaggtcttgcaaa
catttctcggtttgtgtgcctgctgtgcgccccaggcccatctgcttgactgagtctcca
gatttccaacctaatatagcgaagaaatatattgatcagaagtttgtattgcagctttta
gagctctttgacagtgaagatcctcgcgagagagattttcttaaaactacccttcaccga
atctatggaaaattcttaggcttaagagcttacatcagaaaacagataaataatatattt
tatagatttatttatgaaacagagcatcacaatggcatagcagaattactggaaatactg
ggaagtataattaatggatttgccttaccactaaaagaagagcacaagattttcttattg
aaggtgttattacctttgcacaaagtgaagtctctgagcgtctaccatcctcagctggca
tactgtgtagtgcagtttttagaaaaggacagcaccctcactgaaccggtggtgatggca
cttctcaagtactggccaaagactcacagcccaaaagaagtcatgttcctaaatgaacta
gaagagattctagacgtaattgaaccatcagagtttgtgaagatcatggagcctctcttc
cggcagttagccaagtgtgtctccagtccccacttccaggtggcagagcgggcgctgtat
tactggaataacgagtacatcatgagtctcatcagtgacaatgcagcgaagattctgccc
atcatgtttccatccttgtaccgcaactctaagacccactggaacaagacaatacatggc
ttgatatacaatgcgctgaaactcttcatggagatgaaccaaaaactattcgatgactgt
acccagcagtttaaagcagagaaactgaaagagaagctaaaaatgaaagaacgagaagaa
gcatgggttaaaatagaaaacctagccaaagcaaacccccagtacgcggtgtgtagtcaa
gcgagcaccgcgagccttccggtggcagtggagacagatgggcctctattggaagatgtg
cagatgctgagagagacagtgaacgaagaggctcgccagtcggtcgggaggaaagcagtg
acaaccatgcagttaaggaaggtgtag

KEGG   Physeter catodon (sperm whale): 102985008
Entry
102985008         CDS       T06011                                 

Gene name
PPP2R3A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha isoform X1
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03015  mRNA surveillance pathway
pcad04071  Sphingolipid signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04728  Dopaminergic synapse
pcad05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102985008 (PPP2R3A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102985008 (PPP2R3A)
   04151 PI3K-Akt signaling pathway
    102985008 (PPP2R3A)
   04152 AMPK signaling pathway
    102985008 (PPP2R3A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102985008 (PPP2R3A)
  09156 Nervous system
   04728 Dopaminergic synapse
    102985008 (PPP2R3A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102985008 (PPP2R3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102985008 (PPP2R3A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102985008 (PPP2R3A)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102985008 (PPP2R3A)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     102985008 (PPP2R3A)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     102985008 (PPP2R3A)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     102985008 (PPP2R3A)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 DUF4116 DUF4187
Other DBs
NCBI-GeneID: 102985008
NCBI-ProteinID: XP_023987669
UniProt: A0A2Y9THB4
LinkDB
Position
1
AA seq 1151 aa
MAATYRLVVSTVNHYNSVVIDRRFEQAVHYCTGTCHTFAHGVDCIVVHHSVCADLLHIPV
SQFRDADLDSLFLPHENGFSSAEGDYPHQALTGIPRVRKGSTFQNTCNLKDIAGEAISFA
SGKIKEFSLEKLKNSNHAAYRKGRKVKSDSFNRRSVDFDLLCGHYNHDGNSPSFGLLRSS
SVEEKSLSHRNSLDTNLTSLLLHNFSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCS
EDLKKCTDIIKQCIKKKSGSSINEGNGNDAISSSETVYMNVMTRLASYLKKLPFEFMQSG
NNEAIDLTELVSNMPSLQLTPFSPVFGTEQPPKYEDVVQLSAPDSGPFQTIELQDDKHSS
RKTDTVKSIPNNSTNSLCNLEISDPRPLKNVQLQSQSLTMNALGNVSSGNLMETLYIEEE
SDGKKALDKGQRTENGPSQELLRVNEDRAELSDHGSHLKKCPASMQNEIGKIFEKPVVNL
PEEDLKSKVPKVEEGNHRDFMNPNSQEEIDKLLMDLESFSQKMETSLREPLAKGKSSVSL
NSHSQLTGHLPVDLEPKSKVSSPMEKVSPSCLTRIIETNGHKIEEEDRALLLRILESIED
FAQELVECKSGRGNLSQEKEMMQILQETLTTSSQTSLSVCRSPVGDKANDTTSVVLIQQT
PEVIKIQNKPEKKPGAPLPPPATFASSPQPLSPVPHVNNVVNATLSINIPRFYFPEGLPD
ACNNHEQTLSRIETAFMDIEDQKADIYEMGKIAKVCGCPLYWKTPMFRAAGGERTGFVSA
QSFIAMWRKLLSNHHDDASKFICLLAKPSCSYLEQDDFIPLLQDVVDTHPGLTFLKDAPE
FHSRYITTVIQRIFYTVNRSWSGKITATEIRKSNFLQTLALLEEEEDINQITDYFSYEHF
YVIYCKFWELDSDHDLYVSQDDLSRYNDQASSNRIIERIFSGAVTRGKTVQKEGRMSYAD
FVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHD
LLCQMLDLVKPANDGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDS
PEPSDWDRFAAEEYETLVAEESAQAQFQEGSFEDYETEEPASPSEIGNKGNKIVTSSLSE
KCGKLQSVDEE
NT seq 3456 nt   +upstreamnt  +downstreamnt
atggcagcaacttacagacttgtggttagtactgtgaaccactacaacagtgtggtgata
gaccggcgttttgagcaagctgtacattattgcactggaacctgccacaccttcgcacat
ggagttgactgcattgtggtccatcatagtgtttgtgcagacctcttacacatccctgtg
tctcagttcagagatgcagatctggactctctgtttctaccccatgaaaatgggttttcc
tcagctgaaggtgactatcctcatcaggccctcacaggcatacccagggtcaggaaagga
tctacatttcagaacacctgtaacttaaaggacattgcaggagaagcaatcagttttgcc
agtgggaaaataaaagaattttcccttgaaaaactcaaaaactctaaccacgcagcttac
agaaagggaaggaaagttaagtctgactcatttaacaggaggtcagttgattttgacttg
ctctgtggccattataaccatgatgggaactccccatcctttggtttactccggagttcc
tcagttgaggaaaaatctttatcccatagaaactcactcgatacaaacctgacttcattg
cttcttcacaacttctctgaagaagacctggttactcagattttggaaaaacataaaata
gataatttttcttctggaacagacataaagatgtgcttagacatcctgctaaaatgctct
gaggatttgaaaaaatgcacagacatcataaaacaatgtataaagaaaaagtcagggagt
agcatcaatgaaggaaatggtaatgatgcaatttctagctctgaaactgtctatatgaat
gtaatgaccaggttagcatcctatctgaaaaagctaccatttgaattcatgcagtctggg
aataatgaggctatagatttaacagaactggtcagtaatatgcctagtttacagctgact
cccttctccccagtatttggcactgaacagccccctaagtatgaggatgttgtccagctc
tcagcccctgactctggaccctttcaaactatagaattgcaagatgacaagcacagttct
aggaaaacagacactgtaaaatccattccaaacaactctacaaattccttgtgtaattta
gagataagtgatcccagacctctaaaaaatgtccagcttcaatcacagtcattaaccatg
aatgctttaggaaatgtttcttctggtaatctaatggaaaccctttatattgaggaagag
tcagatggaaagaaagcattagataaaggacagaggacagaaaatggacccagtcaggag
ttgttaagggtaaatgaagatagagcagaattatcagatcatggttctcatcttaaaaaa
tgccctgcctcaatgcaaaatgaaattggtaagatatttgagaaaccagttgttaatcta
cctgaggaagatcttaaatcaaaagttcctaaagttgaagagggaaaccacagagatttt
atgaatcctaacagtcaggaagagatagataaattgttaatggatttggaatctttctca
cagaaaatggagacctctctaagagagccacttgccaaaggtaaaagctctgtctctcta
aatagtcatagtcagttgactggtcacctccctgtagatcttgagcctaaatctaaagtc
tcttcacccatggaaaaagtctcaccttcctgcctaacaaggattattgaaaccaacgga
cacaaaatagaggaagaggatcgagccctcttactgcgaattctagaaagcattgaagac
tttgctcaagaactagttgaatgcaaatcaggcagagggaacctatcacaagaaaaagag
atgatgcaaattctacaagaaaccttgacaacttcctcgcagaccagtttatcagtctgt
agaagtcctgttggtgataaagccaatgacactacctcagtggttttgattcagcagacc
ccagaggtgatcaagattcaaaataaaccagaaaagaaacctggagcaccacttccacct
ccagccacctttgcaagtagtccccaacctctctcccctgttcctcatgtgaataatgtt
gtgaatgcaacattatccataaacattccacggttctacttccctgaaggactccccgat
gcctgcaataatcatgaacagactctaagcagaattgaaactgctttcatggatattgaa
gatcagaaagcagacatttatgaaatgggaaaaattgcaaaggtctgtggctgtcctctt
tattggaaaacccccatgttcagggctgcagggggagagaggacaggatttgtgtcagcc
cagtcattcattgccatgtggagaaagttgctgagtaaccatcatgatgatgcctctaag
tttatctgtcttcttgcaaagcccagctgcagctatctagaacaggatgattttattcct
ttacttcaggatgtggtagatacacatcctggcctcacgttcctgaaagatgctccagaa
ttccactcccgctacatcaccacggttattcagagaatattctacacagtcaacagatct
tggagtggaaaaattactgcaacagagataagaaaaagcaactttttgcaaactctagcg
cttttggaagaagaggaagatataaaccaaatcacagattatttctcctatgaacacttc
tatgttatttattgtaaattctgggaactagatagtgatcatgacctctacgtcagccag
gacgatctgtctcgatacaatgaccaggcttcatcaaacaggattattgaaaggatattc
tctggggcagtaacaaggggaaaaacagtacagaaagagggaagaatgagctatgcagat
tttgtttggtttttgatttctgaggaagacaaaaggaaccccaccagcattgagtactgg
ttccgctgcatggatgtggatggggatggtgtgctctccatgtacgagctggaatacttc
tacgaggagcagtgtgaacggatggaagccatgggcattgagcccttgccattccatgat
ctgctgtgccagatgcttgacctggtgaagccagccaacgatggcaaaataactctacga
gatctgaagagatgcagaatggctcacatcttttatgacactttctttaatctggagaaa
tacttagaccatgaacagagagatccctttgcggtccagaaggatgttgagaatgacagt
cctgagccctctgactgggacaggtttgctgctgaggaatatgagacccttgtagcggag
gagtctgcccaagcacagttccaggaaggctcctttgaagattatgaaacagaggaacct
gcctctccctctgaaattggaaacaaaggcaataaaatagtgacctcaagcctttcagag
aaatgtggaaagcttcaatcagtggatgaagaatag

KEGG   Physeter catodon (sperm whale): 102985759
Entry
102985759         CDS       T06011                                 

Gene name
PPP2R2C
Definition
(RefSeq) protein phosphatase 2, regulatory subunit B, gamma isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03015  mRNA surveillance pathway
pcad04071  Sphingolipid signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04390  Hippo signaling pathway
pcad04530  Tight junction
pcad04728  Dopaminergic synapse
pcad05142  Chagas disease
pcad05160  Hepatitis C
pcad05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102985759 (PPP2R2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102985759 (PPP2R2C)
   04071 Sphingolipid signaling pathway
    102985759 (PPP2R2C)
   04151 PI3K-Akt signaling pathway
    102985759 (PPP2R2C)
   04152 AMPK signaling pathway
    102985759 (PPP2R2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102985759 (PPP2R2C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102985759 (PPP2R2C)
  09156 Nervous system
   04728 Dopaminergic synapse
    102985759 (PPP2R2C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    102985759 (PPP2R2C)
   05165 Human papillomavirus infection
    102985759 (PPP2R2C)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102985759 (PPP2R2C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102985759 (PPP2R2C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102985759 (PPP2R2C)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102985759 (PPP2R2C)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     102985759 (PPP2R2C)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     102985759 (PPP2R2C)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     102985759 (PPP2R2C)
SSDB
Other DBs
NCBI-GeneID: 102985759
NCBI-ProteinID: XP_007119793
UniProt: A0A2Y9FCY4
LinkDB
Position
7
AA seq 447 aa
MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNA
PHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKI
TERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRVFANGHTYHINSIS
VNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVY
SSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNN
FFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW
HPAENIIAIAATNNLYIFQDKVNSDMH
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggcgaggacacggacacgcggaaaattaaccacagcttcctgcgggaccacagctat
gtgactgaagccgatatcatctccaccgtcgagttcaaccacactggggagctgctggcc
accggcgacaagggtggccgggtcgtcatcttccagcgggagccggagagtaaaaatgcg
ccgcacagccagggcgagtatgacgtctacagcactttccagagccacgagccggagttc
gactatctcaagagtctggagatagaggagaagatcaacaagatcaagtggctccctcag
cagaatgccgcccactccctgctgtccaccaacgataaaactatcaaactatggaagatt
actgaacgtgataagaggcccgagggttataacctgaaagatgaggaggggaagcttaag
gacctgtccacggtgacgtcactgcaggtgcccgtgctgaagcctatggatctgatggtg
gaggtgagcccccggagggtcttcgccaatggccacacctaccacatcaactccatctcc
gtcaacagcgactgcgagacgtacatgtccgcggacgacctgcgcatcaacctctggcac
ctggccatcaccgaccggagcttcaacatcgtggacatcaagccggccaacatggaggac
ctcacggaggtgatcaccgcgtccgagttccacccgcaccactgtaacctcttcgtctac
agcagcagcaagggctccctgcgcctctgcgacatgcgtgcggccgccctgtgtgacaag
cactccaaactatttgaagagcccgaggaccccagtaaccgctccttcttctcggaaatt
atttcctccgtgtcggacgtgaagttcagccacagcggccggtacatgctcacccgcgat
tacctcacagtcaaggtctgggacctgaacatggaggcgcggcccatagagacctaccag
gtccacgattaccttcggagcaagctctgttccctgtatgagaacgactgcatttttgac
aagttcgaatgcgcctggaatgggagcgacagcgtcatcatgaccggggcctacaacaac
ttcttccgaatgttcgaccggaacaccaagcgggatgtgaccctggaggcgtcgcgggag
agcagcaagccccgggcggtgctcaagccgcggcgcgtgtgcgtgggcggcaagcggagg
cgggacgacatcagcgtggacagcttggacttcaccaaaaagatcctgcacacggcctgg
cacccggccgagaacatcatcgccatcgcggccaccaacaacctgtacatcttccaggac
aaggtgaactccgacatgcactag

KEGG   Physeter catodon (sperm whale): 102987078
Entry
102987078         CDS       T06011                                 

Gene name
PPP2R5E
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03015  mRNA surveillance pathway
pcad04071  Sphingolipid signaling pathway
pcad04114  Oocyte meiosis
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04728  Dopaminergic synapse
pcad05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102987078 (PPP2R5E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102987078 (PPP2R5E)
   04151 PI3K-Akt signaling pathway
    102987078 (PPP2R5E)
   04152 AMPK signaling pathway
    102987078 (PPP2R5E)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102987078 (PPP2R5E)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102987078 (PPP2R5E)
  09156 Nervous system
   04728 Dopaminergic synapse
    102987078 (PPP2R5E)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102987078 (PPP2R5E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102987078 (PPP2R5E)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102987078 (PPP2R5E)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102987078 (PPP2R5E)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     102987078 (PPP2R5E)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     102987078 (PPP2R5E)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     102987078 (PPP2R5E)
SSDB
Motif
Pfam: B56 Sec7_N SBF2
Other DBs
NCBI-GeneID: 102987078
NCBI-ProteinID: XP_023990207
UniProt: A0A2Y9TIM1
LinkDB
Position
11
AA seq 467 aa
MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQP
ELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVS
CNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQPSIAKKYIDQKF
VLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYETEHFNGVAE
LLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFLEKDPSLTE
PVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAKCVSSPHFQVA
ERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLKAFMEMNST
MFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcctcagcaccaactactcctccatcagtggataaagtagacggattttctcggaag
tccgtcagaaaagccagacagaagaggtcgcaaagttcctcacagtttaggtctcaaggc
aagcctattgagttaacacctctgccgctgctaaaagacgttccatcctcagagcagcct
gaactgttcctaaagaaacttcagcagtgctgtgtcatttttgacttcatggacacgcta
tctgatcttaaaatgaaagaatacaagcgctccactcttaatgaactggtggactacatt
acaataagcagaggctgtttgacagagcagacttaccctgaagtagttagaatggtgtct
tgcaatatattcagaactctccctcctagtgacagcaatgaatttgatccagaagaagat
gaacctacccttgaggcatcatggccacacttacagcttgtatatgagtttttcatacga
tttttggaaagccaagaattccaacccagcattgccaaaaaatacatagatcagaaattt
gtattacagcttttggagctgtttgacagcgaagacccacgggaacgggactacttaaaa
acagtcttacacagaatttatggcaagtttcttggtcttagagcatttatccgaaaacag
attaacaatatttttctaaggtttgtttatgaaacagaacacttcaatggtgtagctgaa
ctgctggaaatattaggaagtattatcaatggctttgctttacctcttaaggcagaacac
aaacagtttctggtgaaagtgttgatccctttacacactgtcaggagcttatcactcttc
catgcccagctggcatattgcatagtacagtttctggagaaagatccttcactcacagaa
ccagttattaggggattaatgaaattttggcccaaaacatgtagtcaaaaagaggtcatg
ttccttggggagctggaagaaatattggatgtgattgaaccttcacaatttgttaaaatc
caagaacctttgtttaaacaaattgccaagtgtgtctctagcccccattttcaggtggcg
gaaagggcactctattattggaataatgaatacatcatgagtttgatagaagaaaactct
aatgtcatccttcccatcatgttttccagtctttataggatttcaaaagaacattggaat
ccggctatcgtggcattagtgtacaatgtgttgaaggcgtttatggaaatgaacagcacc
atgtttgatgagctgacagccacatacaagtcagatcgtcagcgtgagaaaaagaaagaa
aaggagcgtgaagaattgtggaaaaaactggaggatctggagttaaagagaggtcttaga
cgtgatgggataattccaacttaa

KEGG   Physeter catodon (sperm whale): 102992184
Entry
102992184         CDS       T06011                                 

Gene name
PPP2R1A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform isoform X2
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03015  mRNA surveillance pathway
pcad04071  Sphingolipid signaling pathway
pcad04114  Oocyte meiosis
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04350  TGF-beta signaling pathway
pcad04390  Hippo signaling pathway
pcad04530  Tight junction
pcad04728  Dopaminergic synapse
pcad04730  Long-term depression
pcad05142  Chagas disease
pcad05160  Hepatitis C
pcad05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102992184 (PPP2R1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102992184 (PPP2R1A)
   04390 Hippo signaling pathway
    102992184 (PPP2R1A)
   04071 Sphingolipid signaling pathway
    102992184 (PPP2R1A)
   04151 PI3K-Akt signaling pathway
    102992184 (PPP2R1A)
   04152 AMPK signaling pathway
    102992184 (PPP2R1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102992184 (PPP2R1A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102992184 (PPP2R1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102992184 (PPP2R1A)
  09156 Nervous system
   04728 Dopaminergic synapse
    102992184 (PPP2R1A)
   04730 Long-term depression
    102992184 (PPP2R1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    102992184 (PPP2R1A)
   05165 Human papillomavirus infection
    102992184 (PPP2R1A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102992184 (PPP2R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102992184 (PPP2R1A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102992184 (PPP2R1A)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102992184 (PPP2R1A)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     102992184 (PPP2R1A)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     102992184 (PPP2R1A)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     102992184 (PPP2R1A)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N CLASP_N TAF6_C M11L Spore_Cse60
Other DBs
NCBI-GeneID: 102992184
NCBI-ProteinID: XP_007106440
UniProt: A0A2Y9EQM8
LinkDB
Position
17
AA seq 589 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcggcggccgacggcgacgattcgctctaccccatcgcggtgctcatagacgagctc
cgcaacgaggatgttcagcttcgcctcaacagcatcaagaagctgtccaccatcgccttg
gcccttggggtcgaaaggacccgcagtgagcttctgcccttccttacagacaccatctac
gatgaggatgaggtcctcttggccctggcggaacagctgggcaccttcaccactctggtc
ggaggccccgagtacgtgcactgcctgctgccacccctggagtcgctggccaccgtggag
gaaaccgtggtgcgggacaaggcggtggagtccctgcgggccatctcgcacgagcactcg
ccctccgaccttgaggcccacttcgtgccgctcgtgaagcggctggcgggcggcgactgg
ttcacctcccgcacgtcggcctgcggcctcttctccgtctgctacccccgcgtgtccagt
gccgtcaaggcggaacttcgacagtacttccggaacctgtgctccgatgacacccccatg
gtgcggcgggccgcagcctccaagctgggggagttcgccaaggtgctggagctggacaat
gtcaagagcgagatcatccccatgttctccaacctggcctctgacgagcaggactcggtg
cggctactagcggtggaggcgtgtgtgaacatcgcccagctcctgccccaggaggatctg
gaggccctggtgatgcccaccctgcgccaggctgctgaggacaagtcctggcgcgtccga
tacatggtggccgacaagttcacagagctccagaaagcagtggggcctgagatcaccaag
acggacctggtccctgccttccagaacctgatgaaagactgtgaggctgaggtgagggcc
gcagcctcccacaaggtcaaagaattctgtgaaaatctctcagctgactgtcgggagaat
gtgatcatgacccagatcttgccctgcatcaaggagctggtgtcagacgccaaccaacat
gtcaagtcggccctggcctcagtcatcatgggcctctctcccatcctgggcaaagacaac
accatcgagcacctcctgcccctcttcctggctcagctgaaggatgagtgcccagaggtg
cggctgaacatcatctccaacctggactgcgtaaacgaggtgattggcatccggcagctg
tcccagtccctgcttcccgccattgtggagctggctgaggatgccaagtggcgagtgcgg
ctggccatcattgagtacatgcctctgctggctggacagctgggggtggagttctttgat
gagaaactcaactccttgtgcatggcctggcttgtagatcatgtctacgccatccgcgag
gcggccaccagcaacctgaagaaactggtggagaagtttgggaaggagtgggcccatgct
accatcatccccaaggtcttggccatgtctggggaccccaactacctgcaccgcatgact
acgctcttctgcatcaacgtgctgtctgaggtctgcgggcaggacatcaccaccaagcac
atgctgcccacagtgctgcgtatggctggggaccccgtcgccaatgtccgcttcaacgtg
gccaagtccctgcagaagatagggcccatcctggacaacagcacactgcagagcgaagtc
aagcccatcctagagaagctgacccaggaccaggacgtggacgtcaagtactttgcccag
gaggctctgactgttctgtctctcgcctga

KEGG   Physeter catodon (sperm whale): 102992659
Entry
102992659         CDS       T06011                                 

Gene name
PPP2R1B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform isoform X1
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03015  mRNA surveillance pathway
pcad04071  Sphingolipid signaling pathway
pcad04114  Oocyte meiosis
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04350  TGF-beta signaling pathway
pcad04390  Hippo signaling pathway
pcad04530  Tight junction
pcad04728  Dopaminergic synapse
pcad04730  Long-term depression
pcad05142  Chagas disease
pcad05160  Hepatitis C
pcad05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102992659 (PPP2R1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102992659 (PPP2R1B)
   04390 Hippo signaling pathway
    102992659 (PPP2R1B)
   04071 Sphingolipid signaling pathway
    102992659 (PPP2R1B)
   04151 PI3K-Akt signaling pathway
    102992659 (PPP2R1B)
   04152 AMPK signaling pathway
    102992659 (PPP2R1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102992659 (PPP2R1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102992659 (PPP2R1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102992659 (PPP2R1B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102992659 (PPP2R1B)
   04730 Long-term depression
    102992659 (PPP2R1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    102992659 (PPP2R1B)
   05165 Human papillomavirus infection
    102992659 (PPP2R1B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102992659 (PPP2R1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102992659 (PPP2R1B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102992659 (PPP2R1B)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102992659 (PPP2R1B)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     102992659 (PPP2R1B)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     102992659 (PPP2R1B)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     102992659 (PPP2R1B)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Adaptin_N Cnd1 CLASP_N M11L AEP1
Other DBs
NCBI-GeneID: 102992659
NCBI-ProteinID: XP_007128319
UniProt: A0A2Y9FQ03
LinkDB
Position
16
AA seq 601 aa
MAGVAGPGTGQGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTR
TELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLESLATVEETVVRDKA
VESLRQISQEHTPVALEAHFVPLVKRLASGDWFTSRTSACGLFSVCYPRASHAVKAEIRQ
HFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTNLASDEQDSVRLLAVEAC
VSIAQLLSEDDLEALVMPTLRQAAEDKSWRVRYMVADKFSELQKAVGPKITLNDLIPAFQ
NLLKDCEAEVRAAAAHKVKELCENLPMEGRETIIMNQILPYIKELVSDTNQHVKSALASV
IMGLSTILGKGNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAI
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVHAIREAATHNLMK
LVQKFGKEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPVVLKM
ARDQVANVRFNVAKSLQKIGPILDTDALQEEVKPVLQKLGQDEDVDVKYFAQEAISVLAL
A
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggcgggcgtggcggggcccggcacgggccagggggcagcgggcggagatggagatgat
tcgctctaccctatcgcggtattaatcgacgagctccgcaatgaggacgtgcagctccgt
ctcaatagtattaagaaattatcaacaattgctctagcacttggagtagaaaggacacga
actgaactgctgcctttccttacagatacaatttacgatgaagatgaggtactgttagct
cttgctgagcagctgggaaatttcactggcctggtgggaggtcctgactttgcccactgt
ttgttgcctcctctggaaagtctggcgaccgtggaagagactgtggttcgagacaaggct
gtggagtccctgaggcagatctcccaggagcacactcctgtggctctggaggctcacttt
gtccctctggtgaaacgcctagcgagtggggattggtttacctctcgcacatctgcatgt
ggtttgttcagcgtttgctatcccagggcttcacatgctgtcaaagcagaaattagacag
cacttccgttccttgtgctcagatgacacaccaatggtacgacgtgctgctgcttccaaa
ctgggtgaatttgcaaaagttttggaattagacagtgtgaaaagtgaaattgttccattg
ttcactaatctagcttctgatgaacaggattcagtgcgcctcctagctgtggaagcttgt
gtcagtattgctcagttactttctgaggatgaccttgaggctttggtgatgcctacactt
cgacaagcagcagaagataaatcttggcgagttcgctatatggtagctgacaaattttca
gagctccagaaagctgtgggtcccaaaatcaccctaaatgacctcatccccgcctttcag
aacctactcaaagactgtgaagctgaagtccgagcagctgctgcccacaaagtaaaagaa
ctttgtgagaacttgcccatggaaggtagagagaccataattatgaatcaaattctgccc
tatataaaggaattagtatctgatacaaatcaacatgtcaagtcggctctagcttctgta
attatgggattgtctacgattttgggcaaagggaataccattgaacatcttctacctctt
tttttagctcagttaaaggatgagtgtcctgaagttcgtttgaacatcatctccaatttg
gattgtgtaaatgaagtgattggaatccggcagctctctcaatcactccttcctgccata
gtggaactggctgaagatgccaaatggagggtccggctggccatcattgagtatatgcca
ctgctggcaggccagctgggtgtggaattctttgatgagaagctgaattctttatgtatg
gcctggcttgtggaccatgtgcatgccatccgtgaggcggccacccacaacctcatgaaa
ctagttcagaagtttggtaaagagtgggcccaaaataccatcgttcccaaagtgttagta
atggcaaatgatcctaactacctgcacagaatgaccactctattctgcatcaatgcgcta
tctgaagcctgtggtcaggaaataaccactaagcagatgctgcctgttgtattgaaaatg
gcaagagaccaagtagcaaacgtccgattcaatgtggccaaatcgctacagaaaattgga
ccaattctagatactgatgctttgcaggaggaagttaagccggtactacagaagctaggc
caagatgaagacgtggatgtcaagtactttgcacaggaagctataagtgtgcttgcattg
gcataa

KEGG   Physeter catodon (sperm whale): 102993492
Entry
102993492         CDS       T06011                                 

Gene name
PPP2R2A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03015  mRNA surveillance pathway
pcad04071  Sphingolipid signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04390  Hippo signaling pathway
pcad04530  Tight junction
pcad04728  Dopaminergic synapse
pcad05142  Chagas disease
pcad05160  Hepatitis C
pcad05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102993492 (PPP2R2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102993492 (PPP2R2A)
   04071 Sphingolipid signaling pathway
    102993492 (PPP2R2A)
   04151 PI3K-Akt signaling pathway
    102993492 (PPP2R2A)
   04152 AMPK signaling pathway
    102993492 (PPP2R2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102993492 (PPP2R2A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102993492 (PPP2R2A)
  09156 Nervous system
   04728 Dopaminergic synapse
    102993492 (PPP2R2A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    102993492 (PPP2R2A)
   05165 Human papillomavirus infection
    102993492 (PPP2R2A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102993492 (PPP2R2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102993492 (PPP2R2A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102993492 (PPP2R2A)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102993492 (PPP2R2A)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     102993492 (PPP2R2A)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     102993492 (PPP2R2A)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     102993492 (PPP2R2A)
SSDB
Motif
Pfam: ANAPC4_WD40
Other DBs
NCBI-GeneID: 102993492
NCBI-ProteinID: XP_007127758
UniProt: A0A2Y9FRF2
LinkDB
Position
9
AA seq 447 aa
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKVN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcaggagctggaggagggaatgatattcagtggtgtttttctcaggtgaaaggagca
gtagatgatgatgtagcagaagcagatataatttctacagtagaatttaatcattctgga
gaattactagcaaccggagataaaggtggtagagtcgtcatctttcaacaggagcaggag
aacaaaatccagtctcatagcagaggagaatataatgtttacagcacctttcagagccat
gaaccagagtttgactacttgaaaagtttagaaatagaagaaaagatcaacaaaattagg
tggttaccccagaaaaatgctgctcagtttttattgtctaccaatgataaaacaataaaa
ttatggaaaatcagtgaaagggacaaaagaccagaagggtataacttgaaagaggaagat
ggaaggtatagagatcctactacagtcactacactacgtgtgccggtctttaggcccatg
gatctaatggttgaggccagtccacgacgaatatttgccaatgctcatacatatcacatc
aactcaatttctattaatagtgattatgaaacgtatttatctgcagatgatttgcggatt
aatctttggcacctggaaattacagacaggagttttaacattgtggatatcaagcctgcc
aatatggaggagctgacagaggtgattacggcagcagaattccatccaaacagttgtaac
acatttgtatacagcagcagtaaaggaactattcggttatgtgacatgagggcatctgcc
ctctgtgataggcattctaaactgtttgaagaacctgaagatccgagtaacaggtctttt
ttttctgaaatcatctcttcaatttctgatgtaaaattcagccatagtggtcgatatatg
atgactagagactatttgtcagtcaaaatttgggacttaaatatggaaaacaggcctgtg
gaaacataccaggtgcatgaatacctcagaagtaaactttgttcactatatgaaaatgac
tgcatatttgacaaatttgaatgttgttggaatggatctgacagtgttgtcatgactgga
tcttacaataatttcttcagaatgtttgaccggaacacaaagcgagacataaccctagaa
gcatcccgggaaaacaataaacctcgcacagttctgaagccacgcaaagtgtgtgcaagt
ggcaagcgaaagaaagatgaaataagcgttgacagcctagacttcaacaagaaaatactt
catacagcctggcaccccaaggaaaatatcattgctgtagctactacaaacaatctgtat
atatttcaagacaaagtgaattag

KEGG   Physeter catodon (sperm whale): 102993796
Entry
102993796         CDS       T06011                                 

Gene name
PPP2CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03015  mRNA surveillance pathway
pcad04071  Sphingolipid signaling pathway
pcad04114  Oocyte meiosis
pcad04136  Autophagy - other
pcad04140  Autophagy - animal
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04350  TGF-beta signaling pathway
pcad04390  Hippo signaling pathway
pcad04530  Tight junction
pcad04728  Dopaminergic synapse
pcad04730  Long-term depression
pcad05142  Chagas disease
pcad05160  Hepatitis C
pcad05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102993796 (PPP2CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102993796 (PPP2CA)
   04390 Hippo signaling pathway
    102993796 (PPP2CA)
   04071 Sphingolipid signaling pathway
    102993796 (PPP2CA)
   04151 PI3K-Akt signaling pathway
    102993796 (PPP2CA)
   04152 AMPK signaling pathway
    102993796 (PPP2CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102993796 (PPP2CA)
   04136 Autophagy - other
    102993796 (PPP2CA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102993796 (PPP2CA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102993796 (PPP2CA)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102993796 (PPP2CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    102993796 (PPP2CA)
   04730 Long-term depression
    102993796 (PPP2CA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    102993796 (PPP2CA)
   05165 Human papillomavirus infection
    102993796 (PPP2CA)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102993796 (PPP2CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102993796 (PPP2CA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102993796 (PPP2CA)
   04131 Membrane trafficking [BR:pcad04131]
    102993796 (PPP2CA)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102993796 (PPP2CA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102993796 (PPP2CA)
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102993796 (PPP2CA)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     102993796 (PPP2CA)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     102993796 (PPP2CA)
Membrane trafficking [BR:pcad04131]
 Autophagy
  Other autophagy associated proteins
   Others
    102993796 (PPP2CA)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     102993796 (PPP2CA)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102993796 (PPP2CA)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N YqzH
Other DBs
NCBI-GeneID: 102993796
NCBI-ProteinID: XP_007113850
UniProt: A0A2Y9F2F6
LinkDB
Position
8
AA seq 309 aa
MDEKVFTKELDQWVEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgagaaggtgttcaccaaggagctggaccagtgggtcgaacagctgaacgagtgc
aagcagctgtccgagtcccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaagaatccaacgtgcaagaagttcgatgtccagtcactgtctgtggagatgtgcatggg
caatttcatgatctcatggaactgtttagaattggtggcaaatcaccagatacaaattac
ttgtttatgggagattatgttgacagaggatattattcagttgaaacagttactctgctt
gtagctcttaaggttcgttaccgtgaacgcatcaccattcttcgaggaaatcatgagagc
agacagatcacacaagtatatggtttctatgatgagtgtttacggaagtatggaaacgca
aatgtttggaaatattttacagatctttttgactatcttcctctcactgccttggtggat
gggcagattttttgtctacatggtggcctctcaccatccatagatacactggatcacatc
agagcacttgatcgcctacaagaagttccccatgagggtccaatgtgtgacttgctatgg
tcagatccagatgaccgtggaggttggggtatatctcctcgaggagctggttacaccttt
gggcaagatatttctgagacatttaatcatgccaatggcctcacgttggtgtctagagct
catcagctggtgatggagggatataactggtgccatgaccgaaatgtagtaacgattttc
agtgctccaaactattgttatcgttgcggtaaccaagctgcaatcatggaacttgatgat
actctaaaatactctttcttgcagtttgacccagcacctcgcagaggcgagccacatgtt
actcgtcgtaccccagactacttcctgtaa

KEGG   Physeter catodon (sperm whale): 102994835
Entry
102994835         CDS       T06011                                 

Gene name
PPP2R5B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03015  mRNA surveillance pathway
pcad04071  Sphingolipid signaling pathway
pcad04114  Oocyte meiosis
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04728  Dopaminergic synapse
pcad05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102994835 (PPP2R5B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102994835 (PPP2R5B)
   04151 PI3K-Akt signaling pathway
    102994835 (PPP2R5B)
   04152 AMPK signaling pathway
    102994835 (PPP2R5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102994835 (PPP2R5B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102994835 (PPP2R5B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102994835 (PPP2R5B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102994835 (PPP2R5B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102994835 (PPP2R5B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102994835 (PPP2R5B)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102994835 (PPP2R5B)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     102994835 (PPP2R5B)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     102994835 (PPP2R5B)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     102994835 (PPP2R5B)
SSDB
Motif
Pfam: B56 FTCD_C
Other DBs
NCBI-GeneID: 102994835
NCBI-ProteinID: XP_007119304
UniProt: A0A2Y9FBM9
LinkDB
Position
16
AA seq 497 aa
METKLPPASTPGSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELT
PLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGSTRGV
LIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPD
FQPSVAKRYVDQKFVLMLLELFDSEDPREREYLKTILHRVYGKFLGLRAYIRKQCSHIFL
RFIYELEHFNGVAELLEILGSIINGFALPLKTEHKQFLVRVLIPLHSVKSLSVFHAQLAY
CVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEMEEILDVIEPSQFVKIQEPLFK
QVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPAVFGTLYQVSKEHWNQTIVSL
IYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKE
VPLQRLTPQVATGGGQS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggagacgaagctgccccccgcgagcacccccggcagcccctcgtccccagggctgtcc
ccggtgcccccacccgacaaggtggacggcttctcccgccgttccctccgcagggcccgg
ccccggcggtcccacagctcctctcagttccgctatcagagcaaccagcaggaactcact
ccgctgcccctgctcaaagatgtgccagcctctgagctgcatgagctgctgagccggaag
ctggcccagtgtggggtgatgtttgacttcttggactgtgtggccgacctgaaggggaag
gaggtgaagcgggcggcgctcaatgagctggtggagtgtgtggggagcactcggggggtc
ctcattgagcctgtctacccggacatcatccgcatgatctcagtgaatatcttccggacg
ctgccgcccagtgagaaccctgaatttgaccctgaagaggatgagcccaaccttgagcct
tcatggccacatcttcagctggtatatgagtttttcctgcgtttcttggagagcccagac
ttccagccctccgtggccaagagatatgtggatcaaaagtttgtcctgatgctcctggag
ctatttgatagcgaggaccctcgggagcgtgagtacctcaagaccatcttgcacagggtc
tatggaaagttcctggggctccgggcctacatccgcaaacagtgcagccatatcttcctc
cggttcatctatgaactcgagcacttcaatggcgtggctgagctgctggagatcttagga
agcatcatcaacggctttgcgctgcccctgaagaccgagcacaagcagtttctggttcga
gtcctgattcccctgcactctgtcaagtcgctgtctgtctttcacgcccagctggcatac
tgtgtggtacagttcctggagaaggatgccactttgacagagcatgtgatccgggggctg
ctcaaatactggccaaaaacctgtacccagaaggaggtgatgtttctgggggagatggaa
gagattctggatgtcattgagccctcccagttcgtgaagatccaggagcccctcttcaag
caggtggctcgctgtgtgtccagcccccatttccaggttgcagagcgggctctgtatttc
tggaacaatgagtatatcctgagcctcattgaggacaactgccatactgtgctgcctgct
gtgtttgggaccctctaccaagtctccaaggagcactggaatcaaaccattgtgtctctg
atctacaatgtgctcaagaccttcatggagatgaatgggaagctgtttgatgagctcaca
gcctcctacaagctggaaaagcagcaggaacagcagaaggcccaggagcgtcaggagctg
tggcaaggcctggaggagctacggctgcgccggttacaggggacccagggggccaaagag
gtcccgctccagcggcttacaccccaggtggccactggtggaggtcagagctaa

KEGG   Physeter catodon (sperm whale): 102996184
Entry
102996184         CDS       T06011                                 

Gene name
PPP2R5D
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03015  mRNA surveillance pathway
pcad04071  Sphingolipid signaling pathway
pcad04114  Oocyte meiosis
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04728  Dopaminergic synapse
pcad05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102996184 (PPP2R5D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102996184 (PPP2R5D)
   04151 PI3K-Akt signaling pathway
    102996184 (PPP2R5D)
   04152 AMPK signaling pathway
    102996184 (PPP2R5D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102996184 (PPP2R5D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102996184 (PPP2R5D)
  09156 Nervous system
   04728 Dopaminergic synapse
    102996184 (PPP2R5D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102996184 (PPP2R5D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102996184 (PPP2R5D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102996184 (PPP2R5D)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102996184 (PPP2R5D)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     102996184 (PPP2R5D)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     102996184 (PPP2R5D)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     102996184 (PPP2R5D)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 102996184
NCBI-ProteinID: XP_007107612
UniProt: A0A2Y9ESU0
LinkDB
Position
Unknown
AA seq 602 aa
MPYKLKKEKEPPKLAKGTAKPSSSSKDGGGESAEEAQPQPQPQPPPQPPPQPPSSNKRPS
NSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQ
KLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLF
RTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFV
LALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAEL
LEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEP
VIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAE
RALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKL
FDDCTQQYKAEKQKGRFRMKEREEMWQRIEELARLNPQYPMFRAPPPLPPVYSMETETPT
AEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQE
AL
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgccctataaactgaagaaggagaaggagccccccaagcttgccaaaggcacggccaag
cccagcagctcgagcaaggatggtggaggcgagagcgctgaggaggcccagccccagccc
cagccgcagccgccaccgcagcctccaccgcagccgccgtcatccaacaagcgtcccagc
aacagcacgccgccccccacacagctcagcaaaatcaagtactcaggggggccccagatt
gtcaagaaggagcgacggcaaagctcctcccgcttcaacctcagcaagaaccgggagctg
cagaagcttcctgccctgaaagactcaccaacccaggagcgggaggagctgtttatccag
aagctacgccagtgctgcgtcctctttgactttgtgtcagacccactcagtgacctcaaa
ttcaaggaggtgaagcgggcagggctcaacgaaatggtggagtacatcacccacagccgt
gatgttgtcaccgaggccatttaccctgaggccgtcactatgttttcagtgaacctcttc
cggacgctgccaccttcatcaaatcccactggggccgagtttgaccccgaggaagatgag
cccaccctggaggccgcctggccgcatctccagctcgtgtacgagtttttcttacgtttc
cttgagtctcccgatttccagccaaacatagccaagaagtacattgaccagaagtttgtc
cttgctctcctggacctgtttgacagtgaggaccctcgagagcgggacttcctcaagacc
atcttgcatcgcatctatggcaagtttttggggctccgggcttatatccgtaggcagatc
aaccacatcttctacaggttcatctatgagacagagcatcacaatgggattgccgagctc
ctggagatcctgggcagcatcatcaatggctttgccttgcccctgaaagaagagcacaag
atgttcctcatccgtgtcctgcttccccttcacaaggtcaagtctctgagtgtctaccac
cctcagctggcgtactgcgtggtacagttcctggagaaggaaagcagcctcactgagccg
gtgatcgtgggccttctcaagttctggcccaagacccacagccccaaggaggtgatgttc
ctgaatgagctagaggagattctggatgtcattgaaccttcagagttcagcaaagtgatg
gaaccactcttccgccagcttgccaagtgtgtctccagcccccatttccaggtggcagag
cgtgccctctattactggaacaatgagtacatcatgagcctgataagtgacaatgctgcc
cgagtcctccccatcatgttccctgcactctacaggaactccaagagtcactggaacaag
acaatccacggcctgatctacaatgccctgaagctgtttatggagatgaatcagaagctg
tttgatgactgtacacaacaatacaaggcagagaagcagaagggccggttccgaatgaag
gagagagaagagatgtggcaacggattgaggagctggctcgccttaacccccagtatccc
atgttccgagcgcctccaccactgcctcctgtgtactcgatggagacggagacccccacg
gcagaggacatccagcttctgaagaggacggtggagacagaggccgtgcagatgctaaag
gacatcaagaaggagaaagtgctgcttcggcggaagtcagagctgcctcaggacgtgtac
accatcaaggcactggaggcgcacaagcgggcggaagagtttctaactgccagccaggag
gcgctctga

DBGET integrated database retrieval system