KEGG   Physeter catodon (sperm whale): 102974383
Entry
102974383         CDS       T06011                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04020  Calcium signaling pathway
pcad04062  Chemokine signaling pathway
pcad04064  NF-kappa B signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04070  Phosphatidylinositol signaling system
pcad04071  Sphingolipid signaling pathway
pcad04150  mTOR signaling pathway
pcad04270  Vascular smooth muscle contraction
pcad04310  Wnt signaling pathway
pcad04370  VEGF signaling pathway
pcad04510  Focal adhesion
pcad04540  Gap junction
pcad04613  Neutrophil extracellular trap formation
pcad04650  Natural killer cell mediated cytotoxicity
pcad04662  B cell receptor signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04670  Leukocyte transendothelial migration
pcad04713  Circadian entrainment
pcad04720  Long-term potentiation
pcad04723  Retrograde endocannabinoid signaling
pcad04724  Glutamatergic synapse
pcad04725  Cholinergic synapse
pcad04726  Serotonergic synapse
pcad04727  GABAergic synapse
pcad04728  Dopaminergic synapse
pcad04730  Long-term depression
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04911  Insulin secretion
pcad04912  GnRH signaling pathway
pcad04916  Melanogenesis
pcad04918  Thyroid hormone synthesis
pcad04919  Thyroid hormone signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04925  Aldosterone synthesis and secretion
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04929  GnRH secretion
pcad04931  Insulin resistance
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad04960  Aldosterone-regulated sodium reabsorption
pcad04961  Endocrine and other factor-regulated calcium reabsorption
pcad04970  Salivary secretion
pcad04971  Gastric acid secretion
pcad04972  Pancreatic secretion
pcad04973  Carbohydrate digestion and absorption
pcad05017  Spinocerebellar ataxia
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05031  Amphetamine addiction
pcad05032  Morphine addiction
pcad05140  Leishmaniasis
pcad05143  African trypanosomiasis
pcad05146  Amoebiasis
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05170  Human immunodeficiency virus 1 infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05214  Glioma
pcad05223  Non-small cell lung cancer
pcad05225  Hepatocellular carcinoma
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102974383 (PRKCB)
   04012 ErbB signaling pathway
    102974383 (PRKCB)
   04014 Ras signaling pathway
    102974383 (PRKCB)
   04015 Rap1 signaling pathway
    102974383 (PRKCB)
   04310 Wnt signaling pathway
    102974383 (PRKCB)
   04370 VEGF signaling pathway
    102974383 (PRKCB)
   04064 NF-kappa B signaling pathway
    102974383 (PRKCB)
   04066 HIF-1 signaling pathway
    102974383 (PRKCB)
   04020 Calcium signaling pathway
    102974383 (PRKCB)
   04070 Phosphatidylinositol signaling system
    102974383 (PRKCB)
   04071 Sphingolipid signaling pathway
    102974383 (PRKCB)
   04150 mTOR signaling pathway
    102974383 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102974383 (PRKCB)
   04540 Gap junction
    102974383 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102974383 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    102974383 (PRKCB)
   04662 B cell receptor signaling pathway
    102974383 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    102974383 (PRKCB)
   04670 Leukocyte transendothelial migration
    102974383 (PRKCB)
   04062 Chemokine signaling pathway
    102974383 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    102974383 (PRKCB)
   04929 GnRH secretion
    102974383 (PRKCB)
   04912 GnRH signaling pathway
    102974383 (PRKCB)
   04921 Oxytocin signaling pathway
    102974383 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    102974383 (PRKCB)
   04918 Thyroid hormone synthesis
    102974383 (PRKCB)
   04919 Thyroid hormone signaling pathway
    102974383 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    102974383 (PRKCB)
   04916 Melanogenesis
    102974383 (PRKCB)
   04925 Aldosterone synthesis and secretion
    102974383 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102974383 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    102974383 (PRKCB)
   04971 Gastric acid secretion
    102974383 (PRKCB)
   04972 Pancreatic secretion
    102974383 (PRKCB)
   04973 Carbohydrate digestion and absorption
    102974383 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102974383 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102974383 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    102974383 (PRKCB)
   04727 GABAergic synapse
    102974383 (PRKCB)
   04725 Cholinergic synapse
    102974383 (PRKCB)
   04728 Dopaminergic synapse
    102974383 (PRKCB)
   04726 Serotonergic synapse
    102974383 (PRKCB)
   04720 Long-term potentiation
    102974383 (PRKCB)
   04730 Long-term depression
    102974383 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    102974383 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102974383 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102974383 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102974383 (PRKCB)
   05206 MicroRNAs in cancer
    102974383 (PRKCB)
   05205 Proteoglycans in cancer
    102974383 (PRKCB)
   05231 Choline metabolism in cancer
    102974383 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102974383 (PRKCB)
   05214 Glioma
    102974383 (PRKCB)
   05223 Non-small cell lung cancer
    102974383 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    102974383 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    102974383 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    102974383 (PRKCB)
   05032 Morphine addiction
    102974383 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102974383 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102974383 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102974383 (PRKCB)
   05161 Hepatitis B
    102974383 (PRKCB)
   05171 Coronavirus disease - COVID-19
    102974383 (PRKCB)
   05164 Influenza A
    102974383 (PRKCB)
   05163 Human cytomegalovirus infection
    102974383 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102974383 (PRKCB)
   05140 Leishmaniasis
    102974383 (PRKCB)
   05143 African trypanosomiasis
    102974383 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102974383 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102974383 (PRKCB)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     102974383 (PRKCB)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   102974383 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 102974383
NCBI-ProteinID: XP_023979189
UniProt: A0A2Y9STV5
LinkDB
Position
14
AA seq 673 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIEREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGSEE
LRQKFERAKINQGTKAPEEKTTNTITKLDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcactgtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcaca
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcaaggattccagtgccaagtctgctgttttgtcgtgcacaagcggtgccatgag
tttgtcactttctcctgcccaggtgctgacaagggtccagcctccgatgacccccggagc
aaacacaagttcaagatccacacatactccagccccacgttttgtgaccactgtgggtca
ctgctgtatggactcatccaccaggggatgaaatgtgacacctgcatgatgaacgtccac
aagcgctgcgtgatgaacgtccccagcctctgcggcacagaccacacggagcgccgcggc
cgcatctacatccaggcccacatcgagagggaggtccttatcgttgtcgtaagagatgct
aaaaaccttgtacctatggaccctaatggcttgtcagatccttacgtgaaactgaaactg
attcctgatcccaagagtgagagcaagcagaagaccaaaaccatcaagtgctccctcaac
cctgagtggaacgagacatttagattccagctgaaagagtcggacaaagacagaagattg
tctgtagagatttgggattgggatctgaccagcaggaatgacttcatgggatctttgtca
tttgggatttctgagctccagaaagctggtgttgatggctggtttaagttacttagccag
gaggaaggcgagtacttcaacgtacctgtgccaccggaaggcagtgagggcagtgaggaa
ctgcggcagaaatttgagagggccaagatcaatcaggggaccaaggctcctgaagaaaag
acgactaacaccataaccaaattggacaacaacgggaacagggaccggatgaaactgact
gattttaacttcctgatggtgcttggaaaaggcagctttggcaaggtcatgctctcagag
cggaagggcacagatgagctgtacgccgtgaagatcctgaagaaggacgtggtgatccaa
gatgacgatgtggaatgcacgatggtagagaagcgggtgcttgccctgcccgggaagccg
cccttcctgacccagctgcactcctgcttccagaccatggaccgcctgtactttgtgatg
gagtatgtgaatggtggcgacctcatgtaccacatccaacaagtgggccggttcaaggaa
cctcacgctgtattttatgctgcagaaattgccatcggtctgttcttcttacagagcaag
ggcatcatttaccgggacctgaaacttgacaatgtgatgctggattctgagggtcacatc
aagatcgctgatttcggcatgtgtaaggaaaacatctgggacggagtgacaaccaagact
ttctgtggtactccagactacatcgcccctgagataattgcttatcagccctacgggaag
tccgtggattggtgggcatttggagtcctgctgtatgagatgttggctgggcaggcaccc
tttgaaggggaggatgaagatgaactcttccagtctatcatggaacacaacgtggcttat
ccaaagtccatgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacacccg
ggcaaacgtctgggttgtggacctgaaggtgaacgtgacatcaaagagcacgcgtttttc
cggtatattgactgggagaaacttgaacgcaaagagattcaacccccgtataagccgaaa
gcctgtgggcgaaatgctgaaaacttcgaccggtttttcacccgccatccaccagtccta
acacctcctgaccaggaagtcatcaggaatattgaccaatcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacctgaagtcaagagctaa

KEGG   Physeter catodon (sperm whale): 102983841
Entry
102983841         CDS       T06011                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04020  Calcium signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04070  Phosphatidylinositol signaling system
pcad04071  Sphingolipid signaling pathway
pcad04150  mTOR signaling pathway
pcad04270  Vascular smooth muscle contraction
pcad04310  Wnt signaling pathway
pcad04370  VEGF signaling pathway
pcad04510  Focal adhesion
pcad04540  Gap junction
pcad04613  Neutrophil extracellular trap formation
pcad04650  Natural killer cell mediated cytotoxicity
pcad04666  Fc gamma R-mediated phagocytosis
pcad04670  Leukocyte transendothelial migration
pcad04713  Circadian entrainment
pcad04720  Long-term potentiation
pcad04723  Retrograde endocannabinoid signaling
pcad04724  Glutamatergic synapse
pcad04725  Cholinergic synapse
pcad04726  Serotonergic synapse
pcad04727  GABAergic synapse
pcad04728  Dopaminergic synapse
pcad04730  Long-term depression
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04911  Insulin secretion
pcad04916  Melanogenesis
pcad04918  Thyroid hormone synthesis
pcad04919  Thyroid hormone signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04925  Aldosterone synthesis and secretion
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04929  GnRH secretion
pcad04935  Growth hormone synthesis, secretion and action
pcad04960  Aldosterone-regulated sodium reabsorption
pcad04961  Endocrine and other factor-regulated calcium reabsorption
pcad04970  Salivary secretion
pcad04971  Gastric acid secretion
pcad04972  Pancreatic secretion
pcad05017  Spinocerebellar ataxia
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05031  Amphetamine addiction
pcad05032  Morphine addiction
pcad05143  African trypanosomiasis
pcad05146  Amoebiasis
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05214  Glioma
pcad05223  Non-small cell lung cancer
pcad05225  Hepatocellular carcinoma
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102983841 (PRKCG)
   04012 ErbB signaling pathway
    102983841 (PRKCG)
   04014 Ras signaling pathway
    102983841 (PRKCG)
   04015 Rap1 signaling pathway
    102983841 (PRKCG)
   04310 Wnt signaling pathway
    102983841 (PRKCG)
   04370 VEGF signaling pathway
    102983841 (PRKCG)
   04066 HIF-1 signaling pathway
    102983841 (PRKCG)
   04020 Calcium signaling pathway
    102983841 (PRKCG)
   04070 Phosphatidylinositol signaling system
    102983841 (PRKCG)
   04071 Sphingolipid signaling pathway
    102983841 (PRKCG)
   04150 mTOR signaling pathway
    102983841 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102983841 (PRKCG)
   04540 Gap junction
    102983841 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102983841 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    102983841 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    102983841 (PRKCG)
   04670 Leukocyte transendothelial migration
    102983841 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    102983841 (PRKCG)
   04929 GnRH secretion
    102983841 (PRKCG)
   04921 Oxytocin signaling pathway
    102983841 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    102983841 (PRKCG)
   04918 Thyroid hormone synthesis
    102983841 (PRKCG)
   04919 Thyroid hormone signaling pathway
    102983841 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    102983841 (PRKCG)
   04916 Melanogenesis
    102983841 (PRKCG)
   04925 Aldosterone synthesis and secretion
    102983841 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102983841 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    102983841 (PRKCG)
   04971 Gastric acid secretion
    102983841 (PRKCG)
   04972 Pancreatic secretion
    102983841 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102983841 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102983841 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    102983841 (PRKCG)
   04727 GABAergic synapse
    102983841 (PRKCG)
   04725 Cholinergic synapse
    102983841 (PRKCG)
   04728 Dopaminergic synapse
    102983841 (PRKCG)
   04726 Serotonergic synapse
    102983841 (PRKCG)
   04720 Long-term potentiation
    102983841 (PRKCG)
   04730 Long-term depression
    102983841 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    102983841 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102983841 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102983841 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102983841 (PRKCG)
   05206 MicroRNAs in cancer
    102983841 (PRKCG)
   05205 Proteoglycans in cancer
    102983841 (PRKCG)
   05231 Choline metabolism in cancer
    102983841 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102983841 (PRKCG)
   05214 Glioma
    102983841 (PRKCG)
   05223 Non-small cell lung cancer
    102983841 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    102983841 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    102983841 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    102983841 (PRKCG)
   05032 Morphine addiction
    102983841 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102983841 (PRKCG)
   05161 Hepatitis B
    102983841 (PRKCG)
   05171 Coronavirus disease - COVID-19
    102983841 (PRKCG)
   05163 Human cytomegalovirus infection
    102983841 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102983841 (PRKCG)
   05143 African trypanosomiasis
    102983841 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102983841 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102983841 (PRKCG)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     102983841 (PRKCG)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   102983841 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 102983841
NCBI-ProteinID: XP_007113139
UniProt: A0A2Y9F1M4
LinkDB
Position
17
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTSDEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKVPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQTEFQGFTYVNPDFVHPDARSPISPAPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcaggcctgggccccggcggaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagccaaccttctgcagccactgcactgacttcatatgggggattgga
aaacagggcctgcagtgtcaagtctgcagctttgtggttcatcgacgatgccacgaattc
gtgaccttcgagtgtccaggcgctgggaagggcccccagacagacgatccccggaacaag
cacaagttccgtctgcacagctacagcagccccaccttctgcgaccactgtggctccctc
ctttacgggctggtgcaccagggcatgaagtgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgcagcgtgccctctctgtgcggcgtggaccacacggagcgccgcggccgc
ctgcagctggaaatccgggctcccacttcggatgagatccacgtcacggttggcgaggcc
cgtaacctcatcccaatggaccccaatggtctgtctgatccctatgtgaaactgaagctc
atcccagatcctcggaatttgacaaaacagaagacccggacggtgaaagccacgctaaac
cctgtgtggaacgagacctttgtgttcaacctgaagccgggggacgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacttcccgcaacgacttcatgggcgccatgtcc
tttggcgtctcggagctgctcaaggttcccgtggacggctggtacaagttactgaaccag
gaggagggcgaatattacaatgtgccagtggctgatgctgacaactgcagcctcctccag
aagtttgaggcctgtaactaccccctggaactgtacgagagggtgcggatgggtccttct
tcttctcccatcccctccccatctcctagtcccaccgactccaaacgctgtttcttcggg
gcaagccctggacgtctgcacatctctgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggccgagcgcaggggctccgatgagctctatgccatcaag
atcctgaagaaagacgtaattgtccaggatgacgacgtggactgcaccctggtggagaaa
cgcgtgttagccctggggggtcgaggccccggaggccggccccactttctcacccagctt
cactccactttccagaccccggatcgcctgtattttgtgatggagtatgtcactgggggc
gacttgatgtaccacattcagcagttgggcaagtttaaggagccccatgcagcgttctac
gcagcagaaatcgccatcggcctcttcttccttcacaatcagggcatcatctatcgggac
ctgaaactggacaacgtgatgctggatgctgaaggacacatcaaaatcactgactttggc
atgtgtaaggagaacgtcttccccgggaccacaactcgcaccttctgtgggaccccagac
tacatagcccccgagatcattgcctaccagccctatgggaagtctgtcgactggtggtcc
tttggggtcctgctgtatgagatgttggcggggcagcccccctttgatggggaggacgag
gaggaactgttccaggccatcatggaacaaactgtcacctaccccaagtcgctttcccgg
gaagctgtggccatctgcaaggggttcctaaccaagcacccagcaaaacgcctgggctcg
gggccagatggagaacccaccatccgagctcatggctttttccgctggatcgactgggaa
cggctggaacgattagagatcgcgcctcctttcagaccccgcccgtgtggccgcagcggc
gagaacttcgacaagttcttcacgcgggcggcgccagcgttgactcccccagaccgccta
gttctggccagcatcgaccaaaccgaattccaaggcttcacctatgtcaacccggatttc
gtgcacccggatgcccgcagccccatcagcccggcacctgtgccagtcatgtaa

DBGET integrated database retrieval system