KEGG   Physeter catodon (sperm whale): 102974641
Entry
102974641         CDS       T06011                                 

Gene name
NOTCH3
Definition
(RefSeq) neurogenic locus notch homolog protein 3 isoform X2
  KO
K20995  Notch 3
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04330  Notch signaling pathway
pcad04371  Apelin signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04919  Thyroid hormone signaling pathway
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05206  MicroRNAs in cancer
pcad05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102974641 (NOTCH3)
   04371 Apelin signaling pathway
    102974641 (NOTCH3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102974641 (NOTCH3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102974641 (NOTCH3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102974641 (NOTCH3)
   05206 MicroRNAs in cancer
    102974641 (NOTCH3)
  09162 Cancer: specific types
   05224 Breast cancer
    102974641 (NOTCH3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102974641 (NOTCH3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102974641 (NOTCH3)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_2 EGF_2 Notch Ank Ank_5 NODP NOD DUF3454 Ank_3 Ank_4 FXa_inhibition cEGF EGF_3
Other DBs
NCBI-GeneID: 102974641
NCBI-ProteinID: XP_023990076
UniProt: A0A2Y9TGL5
LinkDB
Position
2
AA seq 2320 aa
MGPGPRGRRRRRLMSPPPPLPSVRTLPLLLLLAGPGAAAPPCLDGSPCANGGRCTQLPSR
EAACLCPPGWVGERCQLEDPCHSGPCAGHGVCQSSVVAGAARFSCRCPRGFRGPDCSLPD
PCLSSPCAHGARCSVGSDGRYVCSCPPGYQGRSCRSDVDECRMGGPCRHGGTCVNTPGSF
RCQCPAGYTGPLCESPSVACAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDCP
GHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCV
CVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCH
EDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGR
GYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDMDECQSSPCVNG
GVCKDRVNGFSCTCPSGFSGAMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGTV
CEHNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDLV
DKYLCRCPPGTTGVNCEVNIDDCASNPCTFGICRDSINRYDCVCQPGFTGPLCNVEINEC
ASSPCGEGGSCVDGENGFQCLCPPGSLPPLCLPPSHPCAQEPCSHGVCHDAPGGFRCVCE
LGWSGPQCSQSLARDACESHPCWAGGTCTSDGTGFRCTCPPGVQGRQCELLSPCTPNPCE
HGGYCESAPGQLAVCSCPPGWQGSRCQQDVDECAGPSPCGPHGTCTNLAGSFSCTCHEGY
SGPSCDQDIDDCDPNPCLNGGLCQDGVGSFSCSCLPGFAGPRCARDVDECLSSPCGPGTC
TDHVASFTCTCPPGYGGFLCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRLGYTGAHCQH
EADPCLSRPCLHGGVCTAAHPGFRCACPEGFTGTQCQTLVDWCSRTPCQNGGHCARTGAS
FYCLCPPGWSGRLCDIQSLPCREAAAQIGVPMEQLCQAGGQCVDKDSSHHCVCPEGHTGS
HCEREVDPCLAQPCQHGGTCRGYMGGYVCECPAGYTSDNCEDDMDECASQPCQHGGICID
LVARYLCSCPPGTLGVLCEINEDDCGPGPPLDPGPRCLHNGTCVDLVGGFRCTCPPGYTG
LRCEADINECRPGACHAAHTRDCLQDPGGGFRCLCHAGFTGPHCQTVLSPCESQPCQHGG
QCHPSPGSGGALTFSCHCVPPFWGPRCERVARSCWELQCPVGVPCQQTVRGPRCACPPGL
SGPACRGSRGSPLGAANASCVTSPCLHGGSCRPETLAPFFRCACTPGWAGPRCEIPAAVP
EAPEEPSCPRAACEAKSGDKRCDRECNSPGCGWDGGDCSLSVSDPWRQCAALQCWLLFNN
SRCDPACSSPACLYDNFDCRAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLD
CAGEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSGILRTSLRFRLDENGQAMVFPYH
RPGPGSEPRNRRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVER
LDFPYPLRAARGEPLELPEPSVPLLPLLAASAVFLLVILVLGVMVARRKREHSTLWFPEG
FALHKDAAAGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGV
GAEDAVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFC
GGALEAIPAEEDEAEDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLL
DAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVE
GMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLA
AREGSFEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGL
GPLLCPPGAFLPGLKVAQSGGKKSRRPPGKAGLGPQGARGRGKKLTLACPGPLADSSVTL
SPVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGAGRAGLGRQPPGGCVLS
LGLLNPVAVPLEWARLPPPAPPGPSFLLPLAPGPQLLNPGNPVSPQERPPPYLAAPGHGD
EFPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPATATGA
TAAGTLSAQPLPLSVPGPLAQSQTQLGSQPEVTAKRQVLA
NT seq 6963 nt   +upstreamnt  +downstreamnt
atggggccggggccccggggccgccgccgccgtcgcctgatgtcgccgccgccacccctg
ccgtccgtgcggacgctgcccttattgctactgctagcggggccgggggctgcagcgccc
ccttgcctggatggaagcccgtgtgcgaatggaggtcgctgcacccagctgccctcccgg
gaggctgcctgcctgtgcccaccaggctgggtgggtgaacggtgtcagctggaagacccc
tgccattccggcccctgtgctggccatggtgtctgccagagctcggtggtggcaggcgcc
gcccggttctcctgccgctgcccccgtggcttccgaggccctgactgctccctgccagac
ccctgcctcagcagcccctgtgcccatggtgcccgctgctcggtggggtccgatggccgc
tacgtctgctcctgcccacctggctaccagggccgcagctgccgaagcgacgtggatgag
tgccggatgggcggaccctgccgccacggcggcacctgtgtcaacacacctggctccttc
cgctgccagtgcccagctggctacacagggccactgtgtgagagcccctcggtggcctgt
gccccctcgccgtgccgtaacgggggcacctgcaggcagagcggcgacctcacctacgac
tgtgcctgccttcctgggttcgagggccagaactgtgaagtgaatgtggacgactgtcca
gggcaccgatgtctaaatgggggcacgtgtgtggatggtgtcaacacctacaactgccag
tgccctcctgagtggacaggccagttctgtacggaggacgtggacgagtgtcagctgcag
cccaacgcttgccacaatgggggcacttgcttcaacacactgggtggccacagctgtgtg
tgtgtcaatggctggacaggcgagagctgcagtcagaatattgatgactgtgccacggcc
gtgtgcttccatggggccacctgccatgaccgcgtggcctccttctactgtgcctgcccc
atgggcaaaactggacttctgtgtcatctggatgatgcctgcgtcagcaacccctgtcac
gaggacgctatctgcgacacgaacccggtgaacggcagggccatctgcacctgtccacct
ggcttcacaggcggggcttgtgaccaggatgtggatgagtgttccatcggtgccaaccct
tgtgagcacctgggccggtgcgtgaacacacagggctcattcctatgccagtgcggccgt
ggctacactggtccgcgttgcgagaccgatgtcaatgagtgcctctccggcccctgccga
aaccaggccacgtgcctcgaccgtataggccagtttacctgcatctgcatggcaggcttc
acaggcacttattgcgaggtggacatggacgagtgtcagagcagcccgtgtgtcaacggc
ggggtctgcaaggacagagtcaatggcttcagctgcacctgcccctcgggcttcagcggg
gctatgtgtcagctggacgtggatgaatgtgccagcacaccctgccggaatggagccaag
tgcgtggaccagccggatggctatgagtgccgctgcgcagagggcttcgagggcacggtg
tgtgagcacaacgtggatgactgctcgccagacccatgccaccatgggcgctgtgtggat
ggcatcgccagtttctcgtgcgcctgtgccccgggctacaccggcacgcgctgtgaaagc
caggtggatgagtgccgaagccagccctgccgccacggtggcaaatgcctagacctggtg
gacaaatacctctgccgctgccctcccggcaccacaggtgtcaactgtgaggtgaacatt
gatgattgtgctagcaacccctgcacctttggaatctgccgggacagcatcaaccgctat
gactgtgtctgccagcctggcttcacagggcctctctgcaacgtggagatcaacgagtgt
gcgtccagcccatgcggtgaggggggctcctgcgtggatggtgaaaatggcttccaatgc
ctctgcccacctggctccctgcccccgctctgtcttcccccaagccatccctgcgcccaa
gaaccctgcagtcatggcgtctgccacgacgcgcctggagggttccgctgcgtgtgtgag
cttggctggagtggccctcagtgcagtcagagcctcgctcgagatgcctgtgaatcccat
ccctgctgggcaggcggcacctgcaccagtgatggaacgggcttccgctgtacctgtccc
cctggtgtccagggccgtcagtgtgagctgctgtccccctgcaccccaaatccctgtgag
catgggggctactgtgagtctgcccctggccagctggctgtctgctcctgcccccctggt
tggcaaggctcacgatgtcagcaggatgtggatgagtgtgctggcccctcaccctgtggt
ccccatggtacctgcaccaacctggcagggagtttcagctgtacctgccacgagggctat
agtggcccttcctgtgatcaggacatcgatgactgtgaccccaacccctgcctgaatggt
ggcttatgtcaggatggagtgggctccttttcctgctcctgcctacctggctttgctggc
ccccgctgcgcccgagatgtggatgagtgtctgagcagcccctgcggcccaggcacctgc
acagaccacgtggcctccttcacctgcacctgcccgccgggttatggaggcttcctctgc
gagcaggacctacctgactgcagccccagctcctgcttcaacggcgggacctgcgtggat
ggtgtgaactcgttcagctgcctgtgccgcctgggctacactggcgcacactgccaacat
gaggccgacccttgcctctcgcgaccctgcttgcacgggggcgtctgcactgctgcccac
cccggcttccgctgtgcctgccctgaaggcttcaccggcacgcagtgccagacgctggta
gactggtgcagccgcacgccttgtcagaatgggggccactgtgcccggaccggggcctct
ttctactgcctttgccccccgggatggagcggccgcctctgtgacatccagagtctaccc
tgcagagaggccgcagcccaaatcggggtgcctatggagcagctgtgtcaggctggtggg
cagtgtgtggacaaggacagctcccaccactgcgtgtgcccagagggccacacaggcagt
cactgtgagcgggaggtggacccctgcttggcccagccctgccagcatgggggcacctgc
cgaggctacatgggaggttatgtgtgcgagtgtccagctggctacactagtgacaactgt
gaggatgacatggacgagtgtgcctcccagccctgccagcatgggggcatctgcattgac
cttgtggcccgctatctctgctcgtgtcctccaggaacgctgggtgtgctctgcgagatt
aatgaggatgactgtggcccaggcccacccctggacccgggcccccggtgcctgcacaat
ggtacctgtgtagacctggtgggtggcttccgctgcacctgccccccgggatacaccggc
ctgcgctgtgaggcggacatcaatgagtgtcgtccaggtgcctgccatgcggcacatacc
cgggactgcttgcaggacccaggtgggggcttccgctgcctttgtcatgccggcttcaca
ggtccccactgtcagactgtcttgtctccctgtgagtcgcagccatgccagcatggaggc
cagtgccatcccagccccggctctgggggagctctgactttctcttgccactgtgtcccg
ccgttctggggcccgcgttgcgagcgggtggcacgttcctgctgggagttgcagtgcccg
gtgggcgtcccgtgccagcagacggtccgtggaccgcgctgcgcctgccccccggggctg
tcgggtcccgcctgccggggttcccgggggtcaccactgggagccgccaatgccagctgc
gtgacctccccctgcctccacgggggctcctgccgcccggagacgctggcgcccttcttc
cgctgcgcgtgcacgccaggctgggctgggccgcgctgtgagatacctgcagcggtgccc
gaggcccccgaggagccgtcttgcccgagagccgcctgcgaggccaaaagcggcgacaag
cgctgtgaccgagagtgcaacagcccaggctgcggctgggacggcggcgactgctcgctg
agcgtgagcgacccctggcggcagtgcgcggcgttgcagtgctggctccttttcaacaat
agccgctgcgaccccgcctgcagctcgcccgcctgcctctatgacaacttcgactgccgc
gcaggcggccgggagcgcacctgcaacccggtgtatgagaagtactgcgcggaccacttt
gccgacggccgttgcgaccagggctgcaacacagaggagtgcggttgggatggactggac
tgtgcgggtgaggtgccagctctgctggcccgcggcgtcctggtgctcactgtgctgctg
ccgccggaggagctgctgcgctccagcgccgacttcctgcagcggctcagcggcatcctg
cgcacctcgctgcgcttccgtctggatgagaacggccaggctatggtcttcccttaccac
cggcctggtcctggctccgaaccccggaaccggcgggagctggcccctgaggtgatcggc
tctgtggtgatgctggagattgacaaccgtctgtgcctgcagtcgcctgagaatgaccac
tgttttcccgacgcccagagtgcggcggactatctgggagcgttgtcggcggtggagcgc
cttgacttcccgtacccactgcgggcagcacggggggaaccgctggagctgccagagcca
agcgtgccgctgctgcccctgctggctgcgagcgccgtcttcctgctggtcatccttgtc
ctgggcgtcatggtggcccgccgcaagcgtgagcacagtaccctctggttccccgagggc
tttgcactgcacaaggatgctgcagctggccacaagggtcggcgggaacccgtgggccaa
gacgctctgggcatgaagaacatggccaagggtgagagtctgatgggagaggtggccaca
gactggatggacacagagtgcccggaggccaagcgactgaaggtagaggagcctggtgtg
ggagctgaggatgctgtggattgccgccagtggactcaacaccacctggttgctgccgac
atccgtgtggcaccagccatggcattgacgccaccacagggcgatgcagatgctgatggc
atggatgtcaacgtgcgtggtccagatggcttcaccccgctaatgctggcctccttctgt
gggggggccctggaagcaatcccagctgaggaggatgaggcagaagacacgtcagccagc
atcatctcagaccttatctgccagggggcgcagcttggggctcggaccgaccgcacgggt
gagacggccctgcacctggctgcccgctatgcccgggctgatgcggccaagcggctgctg
gatgctggggcagacaccaatgcccaggaccactcaggccgcacccccctgcacacagcc
gtcactgctgatgcccagggtgttttccagattctcatccggaaccgctccacagacctg
gatgcccgcatggcagacggctccacagcactgatcctggcggcccgcctggcagtggag
ggcatggtggaagagctcatcgccagccatgctgatgtcaatgctgtggatgaacttgga
aaatcagccttacactgggctgcagctgtcaacaacgtggaggccaccttggccctgctc
aaaaatggagctaacaaagacatgcaagatagcaaggaggagactccgttgttcctggcc
gccagggagggcagctttgaggctgccaagctgctgctggaccactttgccaaccgtgag
atcacagaccacctggacaggctgccccgggatgtggcccaggagcggctgcaccaggac
atcgtgcgcttgctagaccagcccagtgggccccgtagcccccctggcccccacggcctg
gggcccttgctctgcccgcccggggccttcctcccaggcctcaaggtggcacagtccggg
ggcaagaagagccggaggcctcctgggaaggcggggctggggcctcagggcgcccggggt
cggggcaagaagctgaccctggcctgcccggggccgttggccgacagctcggtcacgctg
tcaccggtggactcgctggactccccgcggccctttggtggcccccccgcatcccctggc
ggcttccccctcgaggggccctacgcggctgctacggccacggccgtgtctctggcacag
cttggtggcgcgggccgggcaggtctcgggcgccagccccccgggggctgtgtgctcagc
ctgggcctgctgaaccccgtggccgtccccctcgagtgggcccggctgcccccacctgcc
ccgccaggtccctccttcctgctgccgctggccccgggaccccagctgctgaaccccggg
aaccccgtgtccccccaggagcggcccccaccgtacctggcagccccaggacatggcgat
gagttccccgcggccggggcccacagcagccccccaaaggcccgcttcctgcgggtcccc
agcgagcacccttacctgaccccatccccagagtcccccgagcactgggccagcccctca
ccgccctcgctctcggactggtccgactccacgcccagcccggccactgccaccggggcc
acggccgctgggacactgtctgcccagcctctccccctgtcggtccctggccctcttgct
cagtcccagacccagctagggtcccagcctgaagtcaccgccaagaggcaagtgttggcc
tga

KEGG   Physeter catodon (sperm whale): 102974807
Entry
102974807         CDS       T06011                                 

Gene name
NOTCH4
Definition
(RefSeq) neurogenic locus notch homolog protein 4 isoform X1
  KO
K20996  Notch 4
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04330  Notch signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05206  MicroRNAs in cancer
pcad05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102974807 (NOTCH4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102974807 (NOTCH4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102974807 (NOTCH4)
   05206 MicroRNAs in cancer
    102974807 (NOTCH4)
  09162 Cancer: specific types
   05224 Breast cancer
    102974807 (NOTCH4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102974807 (NOTCH4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102974807 (NOTCH4)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_2 Ank_5 Notch Ank Ank_3 Ank_4 EGF_2 NODP NOD cEGF EGF_3
Other DBs
NCBI-GeneID: 102974807
NCBI-ProteinID: XP_007118661
UniProt: A0A2Y9FCN7
LinkDB
Position
18
AA seq 1989 aa
MQPPSLLLLLLCRSVVQTRGLQCGSFPEPCANGGTCLSLSQGQGTCQCAPGFLGETCQFP
DPCQDAQLCQNGGSCQALLPTLPSSPSPPSPLAPSFFCTCPSGFTGERCQAQLKDPCSSF
CSKMGRCHIQASGRPRCSCMSGWTGEHCQLRDFCSAKPCVNGGVCLATYPQIQCRCPPGF
EGHACERDVNECFLDPGPCPKGTSCHNTLGSFQCLCPAGWGGPRCELRPGPCPPRGCPNG
GTCQVVPGRDSTFHLCLCPPGFTGPSCEVNPDDCVGHQCHNGGTCQDGLGTYTCLCPEAW
AGWDCSEDVDECEVQGPPRCRNGGTCQNSAGGFHCVCVSGWGGTGCEENLDDCVAATCAP
GSTCIDRVGSFSCLCPPGRTGLLCHMEDMCLSQPCHREAQCNTNPLRGSTFCVCQPGYTG
PTCHQDLDECQMAQQGPSPCEHGGSCLNTPGSFECLCPPGYTGSRCEADHNECLSQPCHP
GSTCLDLLATFQCLCPPGLEGRLCEVETDECASAPCLNQADCHDLLNGFRCVCRPGFTGP
QCEEDINECRSSPCANGGQCQDQPGSFHCKCLPGFEGPRCQAEVDECLSGPCPTGASCLD
LPGAFLCLCPSGFTGHLCEIPLCAPNLCQPKQRCQDLEEEVHCLCPSGNPGCAPAEDNCT
CHHGHCQRSSCVCDVGWTGPECDTELGGCVSTPCAHGGTCHPQPFGFNCTCPTGYTGPTC
SEEVTACHSGPCLNGGSCSPSPGGYSCTCPLSHTGLHCQTSIDHCASAPCLNGGTCVNRP
STSSCLCTTGFQGPRCEGRVRPSCADSPCRNRATCQDGPQGPRCLCPPGYTGGSCQMLMD
SCAQKPCPHNSHCLQTGPSFQCLCLQGWTGPLCNLPLSSCQKAALSQGTEVSSLCQNGGI
CIDNGPSHFCHCPPGFQGSTCQERVNPCESRPCQHGATCMAQPNGYLCQCTPGYSGQNCS
KEPDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSL
ANAFYCQCRPGHTGQWCEVELDPCQSQPCSHGGSCEATAGPPPGFTCHCPQGFEGPTCSH
RAPSCGLHHCHHGGLCLSSPKPGFPPRCACLNGYGGPDCLTPPAPPGCGPPSPCLHNGSC
SETPGLGGPGFRCSCPPSSPGPRCQRPGAKGCEGRSGDGACDAGCSGPGGNWDGGDCSLG
VPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCRDHFHNG
HCEKGCNTAQCGWDGGDCRPEDGDSEWGPSLALLVVLSPSTLDQQLLALARVLSLTLRVG
LWVRKDSDGRNMVYPYPGAQAEEELGGIPDPSHHERAAPQTQPTGKETDSLSTGFVVVMD
VDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAAHPRAGTKPPANQLP
WPVLCSPVAGVLLLALAALLVLQLIRRKRREHGALWLPPGFTRRSQTQPVPRRRRPPLGE
DSIGLKALKPEAEVDEDGVVMCSGPKEGEEADQAEEMASPSKCQLWPLSSDCQELPQAAM
LTPPQDSEMDVPDVDTRGPDGVTPLMSAVCCGGVESRTYQETWLGSPEPWEPLLGGGACP
QVHTVGTGETPLHLAARFSRSTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREVCQLL
LRSRQTAVDARTEDGTTALMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAAVNN
ARAARSLLQAGADKDALDGREQTPLFLAAREGAMEVAQLLLGLGAARGLRDQAGLAPGDI
ARQRNHWDLLTLLEGAGPPEARHKATPGRGAGALQRARTASGSVPPRGGGAQPRCRTLSA
GAYPQARTLSVDLAAHGGGAYSHCRSLSKGAGEGPPLRGRRFSAGMRGPPSNPAIVRGRS
GVAAGSGGVASAVDWPCDWVALGACGPASNTPIPPPCLTPSPERGSPQVAWGPPAHQVIP
LNAGGEGQK
NT seq 5970 nt   +upstreamnt  +downstreamnt
atgcagcccccttcactgctgctgctgctgctgtgtcggtcagtcgtccagaccagaggg
ctgcagtgcgggagtttcccagaaccctgtgccaacggaggcacctgcctgagcctatct
caggggcaagggacctgccagtgtgcccctggcttcctgggtgagacatgccagtttcca
gacccctgccaagatgcccagctctgccagaatggaggcagctgtcaagccctgcttccc
acccttcccagctcccccagccctccctctcccttggcccccagcttcttctgcacctgc
ccctctggcttcactggtgagaggtgccaggcccagctcaaggacccctgttcttccttc
tgttccaaaatgggccgctgccacatccaggcctcgggccgcccacggtgctcctgcatg
tcgggatggacaggtgagcactgccagctccgggacttctgctcagccaagccctgcgtc
aacggaggggtgtgtctggccacatacccccagatccagtgccgctgcccacctggcttc
gagggccatgcctgcgaacgcgatgtcaacgagtgtttcctggacccaggaccctgcccc
aagggcacctcctgccataacaccctggggtctttccagtgcctctgccccgctgggtgg
gggggtccacgctgtgagctccggccaggaccctgcccccccaggggctgtcccaatggg
ggcacctgtcaagtggttccagggagagactccaccttccacctctgcctgtgtccccca
ggtttcacaggcccaagctgtgaggtgaatccagatgactgtgtcgggcaccagtgtcac
aacgggggcacctgtcaggatgggctgggcacctacacctgcctctgcccagaggcctgg
gcaggctgggattgctctgaagatgtggacgaatgtgaggttcagggtccccctcgctgc
agaaacgggggtacctgccagaactcagctggcggcttccattgtgtgtgtgtgagcggc
tggggcggcacaggctgcgaggagaacctggacgactgtgttgccgccacctgtgcccca
ggatccacctgcatcgaccgcgtgggctccttctcctgcctctgcccacctggccgcaca
ggcctcctgtgccacatggaggatatgtgtctgagccagccgtgccaccgggaagcccag
tgcaacaccaaccccctgaggggctctacgttctgcgtgtgtcagcctggctacacgggg
cccacttgccaccaggacctggacgagtgtcagatggcccagcaaggccccagtccctgt
gaacatggcggctcctgcctcaacacgcccggctcctttgagtgcctctgtccccctggc
tacacgggatcccgctgcgaggccgaccacaatgagtgcctgtcgcagccctgccaccct
ggcagcacctgcctggacttgctcgccacgttccagtgcctctgcccaccaggcttagaa
gggcggctctgtgaggtagagacagacgagtgcgcctctgccccttgcctgaaccaggct
gactgccacgacctgctcaatggcttccggtgcgtctgccggcctggattcaccggccct
cagtgtgaggaggacatcaacgagtgcagaagctctccctgcgccaacggtgggcagtgc
caggaccagcctggatccttccattgcaagtgtctcccaggctttgaaggaccacgctgt
caggcagaggtggacgagtgtctgagtggcccatgccccactggagccagctgccttgac
ctcccgggagctttcctttgcctctgcccatctggcttcacaggtcatctctgtgaaatt
cccctgtgtgcccccaacctgtgccagcccaagcaaagatgccaggatctggaggaagag
gtccactgcctctgccccagtggaaaccctggctgtgccccagctgaagacaactgcacc
tgccaccatgggcactgccagagatcctcgtgtgtgtgtgatgtgggttggacaggacca
gagtgtgacacagagctggggggttgcgtctccacaccctgtgcccacggagggacctgc
cacccccagccctttggcttcaactgcacctgccccacaggttacacagggcccacttgc
agcgaggaggtgacagcttgtcactcagggccctgtctcaacggtggttcctgtagcccc
agccctgggggctactcctgcacctgccctctgagccacaccgggcttcactgccagacc
agcattgaccactgtgcctctgcaccgtgcctcaatgggggcacctgtgtgaacaggccc
agcacctcctcctgcctctgcaccacgggcttccagggcccacgctgcgagggaagggtc
cgtcccagctgtgcggacagcccctgtaggaacagggcaacctgccaagacggccctcag
ggtccccgctgcctctgtccccctggctacacaggaggcagctgccagatgctgatggac
tcatgtgctcagaagccctgtccacacaattcccactgcctccagactgggccctccttc
cagtgcctgtgcctccagggatggactggacctctctgcaatctaccgctgtcctcctgc
cagaaggctgctctgagccaaggcacagaagtctcttccctgtgccagaatggaggcatc
tgcatcgacaacggcccctcccatttctgccactgtccccctggattccaaggcagtaca
tgccaggagagggtgaacccctgtgagtccaggccctgccagcacggggccacctgcatg
gcccaacctaatggttatctctgccagtgtacaccaggctacagtggacagaactgctca
aaggaacctgacgcttgtcaatcccagccctgtcacaaccatggaacgtgcacccccaaa
cctggaggcttccactgtgcctgccctccaggctttgtggggctgcgctgcgagggggac
gtggatgagtgtctggaccagccctgtcaccccacaggcacagcagcctgccactctctg
gccaatgccttctactgccagtgtcggcctggacacacaggccagtggtgtgaagtggag
ctagacccctgccagagccagccctgctcccacggagggtcttgtgaggccacagcagga
ccacccccaggattcacctgccactgcccacagggttttgaaggccccacctgcagccac
agagccccctcctgcggtctccatcactgccaccacggtggcctgtgtctttcctccccc
aagcctggattcccaccccgctgtgcctgcctcaatggctatgggggccctgactgcctg
accccacccgctcctccaggctgtggccctccttctccatgcctacacaatggcagctgc
tcagagacccctgggctggggggcccaggctttcgatgctcctgccctcccagctctcca
gggccccggtgtcagaggcctggagcaaagggatgtgagggcagaagtggagatggggcc
tgcgacgctggctgcagcggcccaggaggaaattgggatggtggggactgctccttgggg
gtcccagacccctggaagggctgcccctcccattctcggtgctggcttctcttccgggat
gggcagtgccatccacagtgtgactctgaagagtgtctgtttgatggctatgactgtgag
actcctccagcctgcactccagcctatgaccagtactgccgtgatcacttccacaacgga
cactgtgagaagggctgcaacactgcacaatgtggctgggatgggggcgactgcaggccc
gaagatggggattcagagtggggaccctccctggccctgctggtggtgctgagcccctca
accctggaccagcagctgcttgccctggcccgggtgctgtccctgactctgagggtaggg
ctttgggtaaggaaggatagtgatggcaggaacatggtgtacccctatcctggagcccag
gccgaagaggagctaggaggaatcccagacccctctcaccatgagagagcagcccctcaa
acacagcctacaggcaaggagacggactccctcagcaccgggtttgtggtggtgatggat
gtggacttgtcccgctgtggccccgaccatcctgcatcccgctgtccctgggaccctggg
ctcctgctccgcttccttgctgcgatggccgcagtgggggccctggagcccctactgcca
ggacccctgctggctgcccaccctcgtgcaggcaccaagccccccgccaaccagcttccc
tggcctgtactgtgctcgccggtggccggggtgctcctcctggccctcgcggctcttctc
gtcctccagctcatccgccggaagcgccgagagcatggggccctctggctgccccctggg
ttcactcgaaggtctcagactcagccagttccccgcagacgccggccccccctgggcgag
gacagcatcggcctcaaggcactgaaaccagaggcagaagttgatgaggatggagttgtg
atgtgctcaggccccaaggaaggagaagaggcggaccaggctgaagaaatggcctcaccc
tccaagtgccagctctggcctctgagcagtgactgtcaggaactcccccaggcagccatg
ctgactcctccccaggattctgagatggatgtccctgatgtggacacccgtggacctgat
ggggtgacaccccttatgtcagcagtctgctgtgggggagtggagtccaggacctatcag
gagacatggttgggaagccctgagccctgggaacctctgctgggtggaggggcctgtccc
caggttcacaccgtgggcactggggagacccccctgcacctggctgctcgattctcccgg
tcaaccgctgcccgccgcctcctcgaggcaggagccaaccccaaccagccagaccgggca
gggcgcaccccccttcacaccgctgtggctgctgatgctcgggaggtttgccagctctta
ctccgcagcagacagactgcagtagatgcgcggacagaggatgggaccacagccctgatg
ctggccgccaggctagctgttgaggacctggttgaagaactgattgcagcccaagcagat
gtgggggccagagataaatggggaaaaacagcgctgcactgggccgccgccgtgaacaac
gcccgggccgcccgctcccttctccaagccggagccgataaagacgcactggacggcagg
gagcagacgccgctgttcctggcggcccgagaaggagccatggaggtagcccagctgctg
ctggggctgggagccgcccgagggctgcgggaccaagccgggctagcgcccggggacatc
gcccgccagcgcaaccattgggatctgctgacgctgctggaaggggcgggaccaccggag
gctcgtcacaaagccacgccgggccgcggcgccggcgccttgcagcgcgcgcgaaccgca
tcaggaagcgtgcccccgcgtgggggcggggctcagccgcgctgccggacgctgtcagcc
ggagcctatcctcaagcccggactttgtccgtagacttggccgcccatgggggcggggcc
tattcgcactgccgaagcctatcgaaaggagcaggagaaggcccgcccctccgcggccgt
aggttttctgcaggcatgcgcgggcctccgtccaaccctgcaatagtgcgaggaagatcc
ggggtcgcggccgggagcgggggtgtggcctcagctgttgactggccctgcgattgggtg
gctctaggagcctgcggccccgcctccaacactccaatcccgcctccttgccttactccg
tcccctgagcggggatcccctcaagttgcgtggggtcccccagcccaccaagtaataccc
ttaaatgcgggaggcgagggtcagaaataa

KEGG   Physeter catodon (sperm whale): 102982122
Entry
102982122         CDS       T06011                                 

Gene name
NOTCH1
Definition
(RefSeq) neurogenic locus notch homolog protein 1
  KO
K02599  Notch 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04330  Notch signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04919  Thyroid hormone signaling pathway
pcad05020  Prion disease
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05206  MicroRNAs in cancer
pcad05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102982122 (NOTCH1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102982122 (NOTCH1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102982122 (NOTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102982122 (NOTCH1)
   05206 MicroRNAs in cancer
    102982122 (NOTCH1)
  09162 Cancer: specific types
   05224 Breast cancer
    102982122 (NOTCH1)
  09164 Neurodegenerative disease
   05020 Prion disease
    102982122 (NOTCH1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102982122 (NOTCH1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102982122 (NOTCH1)
SSDB
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Ank_2 Notch NOD Ank NODP DUF3454 Ank_5 Ank_4 Ank_3 EGF_3
Other DBs
NCBI-GeneID: 102982122
NCBI-ProteinID: XP_023982178
UniProt: A0A2Y9SVH2
LinkDB
Position
13
AA seq 2531 aa
MPPLVAPLLCLALLPALAARGLRCSQPGETCLNGGRCEVFPNGTEACVCSGAFVGQRCQA
PNPCLSAPCKNGGTCHTVERDGLVDYACRCRLGFSGPLCLTPRDHACLASPCLNGGTCDL
LTLTEYKCLCPPGWSGKTCQQADPCASNPCANGGQCLPFEASYICGCPPGFHGPTCRQDI
NECSQNPGLCHHGGTCHNEVGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDT
AHECACLPGFTGQNCEANIDDCPGNSCKNGGACVDGVNTYNCRCPPEWTGQHCTEDVDEC
QLMPNACQNGGTCHNAHGGYTCVCVNGWTGEDCSENIDDCASASCFHGATCHDRVASFYC
ECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLG
ANPCEHAGKCINTLGSFECQCLQGYAGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICM
PGFEGVHCEVNTDECASSPCLQNGRCLDKINEFVCECPTGFTGHLCQYDVDECASTPCRN
GAKCLDGPNTYTCACTEGYTGPHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHH
CETNINECHSQPCRHGGSCQDRDDAYLCFCLKGTSGPNCEINLDDCASSPCDSGTCLDKI
DGYECVCEPGYTGSMCHINIDECADNPCHNGGTCEDGVNSFTCRCPEGYHDPTCLSEVNE
CSSNPCIHGACRDSLNGYKCDCDPGWSGANCDINNNECESNPCVNGGTCKDMTSGYVCAC
RGGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGAACEAVLAPCAPGPCR
NGGECKESKDYQSFSCACPVGWQGQTCEIDVNECVKSPCRAGASCQNTNGGYRCHCQAGY
TGRNCETDVDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCRNGAN
CTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQ
HDVNECDSRPCLHGGTCHDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGRCWQTNA
LYRCECHSGWTGLYCDVPSVSCEVAAWQQGINVTHLCRNGGLCMNVGNTHHCHCQAGYTG
SYCEDQVDECSPSPCQNGATCTDYPGGYSCECVAGYHGVNCSEEVNECLSQPCRNGGTCI
DLTNTYKCSCPRGTQGVHCEINVDDCDPPTDPASRGPKCFNNGTCVDQVGGYSCTCPPGF
VGERCEGDVNECLSNPCDARGTQNCVQRVNAFHCECRAGHTGRRCESVINGCKDRPCKNG
GSCAVASNTARGFICKCPAGFEGATCENDARSCGSLRCLNGGTCISGPRSPTCLCLGPFT
GPECQFPVSSPCVGGNPCYNQGSCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGVGLD
IPPPQIEEACELPGCREEAGNKACSLQCNNHACGWDGGDCSLNFNDPWQNCTQSLQCWKY
FSNGRCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFRDGHCDQGCNSAECEWDGL
DCAEHVPERLAAGTLVLVVLMPPEQLRNRSLHFLRELSRLLHTNVVFKRDASGQQMIFPY
YGREEELRKHPIRRSVDAGASLLPGSGGGGGRRRRELDPMDIRGSIVYLEIDNRQCVQSS
SQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPPPLHFMYVAVVAFVLLFF
VGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDS
QNAWGDEGLEAKKFRFEEPVVLPDPDDQTDHRQWTQQHLDAADLRVSAMAPTPPQGEADT
DCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGE
TALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVAADAQGVFQILIRNRATDLD
ARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVEAAVVLLK
NGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDI
VRLLDEYSLVRSPPLHGAPTLSPPLCSPSGYLGNLKPAVQGKKARKPSTKGLACGGKEPK
DLKARRKKSQDGKGCLLDSSSVLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSVPLNHL
PGMPDAHLGVSHLSVAAKPEVAALSGGGRLAFEAGPPRLSHLPVASGTSTVLGAGGGRSC
GGAVNLTVGGAAGLNGQCEWLSRLQNGLVPNQYNPLRGSVAPGTLSAQAPALQHGMVGPL
HGGLSAAALSQMMSYQALPNTRLAAQPHLVQPQQQQQNLQMQPPNMQPQAPQPHLGVGSA
TGGHMGRSFLAGELSQADVQPLGPGSLAAHTVLPQDSQVLPTSLPAALAPPMTTAQFLTP
PSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPRSNISDWSEGISSPPTSMP
SQIAHVPEAFK
NT seq 7596 nt   +upstreamnt  +downstreamnt
atgccgcctctcgtggcgcccctgctctgcctggcgctgctgcccgcgctcgccgcacga
ggcctgcgatgttcccagcccggcgagacctgcttgaatggcgggaggtgtgaagtgttc
cccaacggcaccgaggcctgtgtctgcagcggggcctttgtgggccagcgatgccaggcg
cccaacccctgcctcagcgccccctgcaagaacggcgggacgtgccacacggtggagcgc
gacggcctggtggactacgcctgccgctgccgcctgggcttctcggggccgctgtgcctg
acgccccgcgaccacgcctgcctcgccagcccctgcctcaacggcggcacctgtgacctg
ctcactctcaccgagtacaagtgcctctgccccccgggttggtcagggaagacatgccag
caggccgacccctgcgcctccaacccctgtgccaacggtggccagtgcctgcccttcgag
gcctcgtacatctgcggctgcccacccggcttccacggccccacctgcaggcaggacatc
aacgagtgcagccagaaccccgggctctgccaccacggtggcacctgccacaatgaggtc
ggctcctaccgctgcgcctgccgcgccacccacaccggcccccactgcgagctgccctac
gtgccctgcagcccctccccctgccagaacgggggcacctgccgccccacgggggacacc
gcccacgagtgcgcctgcctgccaggcttcaccggccagaactgtgaggcaaacatcgac
gactgtccaggaaacagctgcaagaacggaggcgcctgtgtggacggcgtgaacacctac
aactgccgctgccccccggagtggacaggtcagcactgcaccgaggacgtggacgagtgc
cagctcatgcctaacgcctgccagaacggcgggacctgccacaacgcccacggcggctac
acctgcgtgtgcgtcaacggctggacgggcgaggactgcagcgagaacattgatgactgc
gccagcgcctcctgcttccacggcgccacctgccacgaccgcgtggcctccttctactgc
gagtgtccccacggccgcacaggtctgctgtgccacctcaacgatgcctgcatcagcaac
ccctgcaacgagggctccaactgcgacaccaaccccgtcaacggcaaggccatctgcacc
tgcccctcgggctacacggggccggcctgcagccaggacgtggacgagtgctcgctgggc
gccaacccctgtgagcacgcgggcaagtgcatcaacacgctgggctccttcgagtgccag
tgtctgcagggctacgccggcccgcgctgcgagatcgacgtcaacgagtgtgtgtcgaac
ccgtgtcagaacgacgccacctgcctggaccagatcggggagttccagtgcatctgcatg
cccggcttcgagggcgtgcattgcgaggtgaacacggacgagtgcgccagcagcccctgc
ctccagaacggccgctgcctggacaagatcaacgagttcgtgtgcgagtgtcccacaggc
ttcaccgggcacctgtgccagtacgacgtggacgagtgcgcgagcacgccctgcaggaat
ggcgccaagtgcctggacgggcccaacacctacacgtgcgcgtgcacggaaggctacacg
gggccccactgtgaggtagacattgacgagtgcgaccccgacccctgccactacgggtcc
tgcaaggacggcgtcgccaccttcacctgcctgtgccgcccgggctacacgggccaccac
tgcgagaccaacatcaacgagtgccacagccagccctgccgccacgggggctcctgccag
gaccgcgacgacgcttacctctgcttctgcctcaaggggacctcaggacccaactgtgag
atcaacctggacgactgcgccagcagcccctgtgactcgggcacctgtctggacaagatt
gacggctacgagtgtgtctgtgagccgggctacacagggagcatgtgccacatcaacatc
gacgagtgcgcggacaacccctgtcacaacggcggcacctgcgaggacggcgtcaacagc
ttcacctgccgctgccccgagggctaccacgaccccacctgcctgtccgaggtcaacgag
tgcagcagcaacccctgcatccatggggcctgccgggacagcctcaacgggtacaagtgt
gactgtgaccccgggtggagcggggccaactgtgacatcaacaacaacgagtgtgagtcg
aacccctgcgtcaacgggggcacctgcaaggacatgaccagcggctacgtgtgcgcgtgc
cggggaggcttcagtggccccaactgccagaccaacatcaacgagtgtgcgtccaacccg
tgtctgaaccagggcacgtgcatcgatgatgtggctgggtacaagtgcaactgcctcctg
ccctacacaggagccgcgtgcgaggcggtgctggccccatgtgcccccggcccctgcaga
aacggcggcgagtgcaaggagtccaaggactaccagagcttctcctgcgcctgccctgtg
ggctggcaggggcagacctgcgagattgacgtcaacgagtgcgtgaagagcccgtgccgc
gcgggagcctcctgccagaacaccaacggtggctaccgctgccactgccaggccggctac
acggggcgaaactgcgagacggacgtcgatgactgccggcccaacccatgccacaacggg
ggctcctgcacagacggcatcaacacggccttctgcgactgcctgcccggcttccagggc
gccttctgcgaggaggacatcaacgagtgcgccagcaacccctgccgcaatggcgccaac
tgcaccgactgcgtggacagctacacctgcacctgccccgcgggcttcagcgggatccac
tgtgagaacaacacgcctgactgcacggagagctcctgcttcaacggcggtacctgcgtg
gacggcatcaactcctttacctgcctgtgcccgccaggcttcacgggcagctactgccag
cacgacgtcaacgagtgcgactctcggccctgcctgcacggtggcacctgccacgacagc
tatggcacctacaagtgcacctgcccgcagggctacactggcctcaactgccagaacctc
gtgcgctggtgtgactcctcgccctgcaagaatggcggcaggtgctggcagaccaacgcc
ttgtaccgctgcgagtgccacagtggctggaccggcctctactgcgacgtgcccagcgtc
tcctgcgaggtggccgcgtggcagcaaggcatcaatgttacccacctgtgccggaacgga
gggctctgcatgaacgtgggcaacacgcaccactgccactgccaggcgggctacacgggc
agctactgcgaggaccaggtagacgagtgctcgcccagcccctgccagaacggggccact
tgcaccgactaccctggtggctactcctgcgagtgtgtggctggctaccacggcgtgaac
tgctccgaggaggtcaacgagtgtctgtcccagccgtgccggaatgggggcacctgcatc
gacctcaccaacacctacaagtgctcctgcccccggggcacacagggcgtgcactgtgag
atcaacgtggacgactgcgacccccccaccgaccccgcgtcccggggccccaagtgcttt
aacaacggcacctgcgtggaccaggtgggcggctacagctgcacctgcccgcccggcttc
gtgggcgagcgctgtgagggcgatgtcaacgagtgcctgtccaacccctgcgacgcccgc
ggcacccagaactgcgtgcagcgcgtcaacgccttccactgcgagtgccgcgccggccac
accgggcgccgctgtgagtcggtcatcaacggctgcaaggacaggccctgcaagaacggg
ggcagctgtgccgtggcctccaacaccgcccgcgggttcatctgcaaatgcccagcgggc
ttcgagggtgccacgtgtgagaacgacgcacgcagctgcggcagcctgcgatgcctcaac
ggcggcacctgcatctcgggcccgcgcagccccacctgcctgtgcctgggccccttcacc
ggccccgagtgccagttccctgtcagcagcccctgcgtgggtggcaacccctgctacaac
cagggcagctgcgagcccacgtccgagagccccttctaccgctgcctgtgccccgccaag
ttcaacgggctcctgtgccatatcctggactacagcttcggcggtggcgtgggcctcgac
atccccccgccgcagatcgaggaggcctgcgagctccccggctgccgcgaggaggccggc
aacaaggcctgcagccttcagtgcaacaaccacgcctgtggctgggacggcggcgactgc
tccctcaacttcaacgacccctggcagaactgcactcagtccctgcagtgctggaagtac
ttcagcaacggccgctgcgacagccagtgcaactcggccggctgcctcttcgacggcttc
gactgccagcgcgcagaaggccagtgcaaccccctgtacgaccagtactgcaaggaccac
ttcagggacgggcactgcgaccagggctgcaacagcgccgagtgcgagtgggacgggctg
gactgcgcggagcacgtgcccgagcgcctggcggccggcacgctggtgctggtggtgctg
atgccgcccgaacagctgcgcaaccgctccctgcacttcctgcgcgagctcagccgcctg
ctgcacacgaacgtggtcttcaagcgcgacgccagcggccagcagatgatcttcccctac
tacggccgcgaggaggagcttcgcaagcaccccatcaggcgctctgtggacgccggggcc
tcgctgctcccgggcagcgggggcgggggcgggcgccggcgcagggagctggaccccatg
gacatccgcgggtccatcgtctacctggagatcgacaaccggcagtgcgtccagtcgtcc
tcccagtgcttccagagcgccacggatgtggccgccttcctgggcgcgctcgcctcgctg
ggcagcctcaacatcccctacaagatcgaggccgtgcagagtgagacggtggagccgccc
ccgcccccgccgctgcacttcatgtacgtggccgtggtggccttcgtgctgctcttcttc
gtgggctgcggggtgctgctgtcgcggaagcgccggcggcagcatggccagctctggttc
cccgagggcttcaaggtgtcggaggccagcaagaagaagcggcgggagcccctcggcgag
gactccgtgggcctcaagcccctgaagaacgcctcggacggcgccctcatggacgacagc
cagaacgcgtggggcgacgagggcctggaagccaagaagttccggttcgaggagcccgtg
gtccttcccgacccggatgaccagacagaccaccggcagtggacccagcagcacctggac
gccgctgacctccgcgtgtccgccatggcccccacgccgccccagggcgaagccgacacc
gactgcatggacgtcaatgtccgcgggccggacggcttcacgcccctcatgatagcctcc
tgcagtggagggggcctggagacgggcaacagcgaggaggaggaggacgcgcccgcggtc
atctcggacttcatctaccagggcgccagcctgcacaaccagacggaccgcaccggcgag
accgccctgcacctggctgcccgctactcgcgctcggacgcggccaagcgcctgctggag
gccagcgctgacgccaacatccaggacaacatggggcgcaccccgctgcacgcggccgtg
gctgccgacgcgcagggtgtctttcagatcctgatccggaaccgagccacggacctggac
gcccgcatgcacgacggcacaactccactgatcctggccgcccgcctggccgtcgagggc
atgctggaggacctcatcaactcccatgccgacgtcaacgccgtggacgacctgggcaag
tccgccctgcactgggccgccgcggtgaacaacgtggaggccgccgtcgtgctcctgaag
aacggggccaacaaggacatgcagaacaacaaggaggagacgcccttgttcctggccgcc
cgggagggcagctacgagacggccaaggtgctgctggaccatttcgccaaccgggacatc
acggaccacatggaccgcctgccccgcgacatcgcgcaggagcgcatgcaccacgacatc
gtgcggctgctggacgagtacagcctggtgcgcagccccccgctgcacggcgcgcccacc
ctgtcgcccccgctctgctctcccagcggctacctgggcaacctgaagcccgccgtgcag
ggcaagaaggcccgcaagcccagcaccaagggcctggcctgcggcggcaaggagcccaag
gacctcaaggcgcggaggaagaagtcgcaggacggcaagggctgcttgctggacagctcg
agcgtgctgtcgcccgtggactccctggagtccccccacggctacctgtcggatgtggcc
tccccgcccctcctgccctcccctttccagcagtctccctctgtgcccctcaaccacctg
cccgggatgcccgacgcccacctgggcgtcagccacctgagcgtggcggccaagcccgag
gtggcagcgctgagtgggggtggccggctggccttcgaggcggggccgccacgcctctcc
cacctgcccgtggcttccggcaccagcacggtcctgggtgccggcggcggcagaagctgc
ggtggggccgtgaatctcaccgtgggcggggccgcaggcttgaacggccagtgcgagtgg
ctgtcccggctgcagaacggcctggtgccgaaccagtacaacccgctgcgagggagcgtg
gcgccgggcaccctgagcgcgcaggcccccgccctgcagcacggcatggtgggcccgctg
cacggcggcctgtctgccgccgccctgtcccagatgatgagctaccaggccctgcccaac
acgcggctggccgcccagcctcacctggtgcagccacagcagcaacagcagaacttacag
atgcagccaccgaacatgcagccgcaggcaccgcagccgcacctcggcgtgggctcggcc
accggcggccacatgggccggagcttcttggcgggggagctgagccaggcggacgtgcag
cccctgggccccggcagcctggcggcgcacaccgtcctgccgcaggacagccaggtcctg
cccacgtcgctgccggccgcgctggccccgcccatgaccaccgcccagttcctgacgccc
ccctcccagcacagctactcctcccccgtggacaacacccccagccaccagctgcaggtg
cccgagcaccccttcctcaccccgtccccggagtcccccgaccagtggtccagctcgtcg
ccacgctccaacatctccgactggtccgagggcatctccagcccgcccaccagcatgccg
tcccagatcgcccacgttcctgaggcctttaagtaa

KEGG   Physeter catodon (sperm whale): 102990689
Entry
102990689         CDS       T06011                                 

Gene name
NOTCH2
Definition
(RefSeq) neurogenic locus notch homolog protein 2
  KO
K20994  Notch 2
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04330  Notch signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04919  Thyroid hormone signaling pathway
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05206  MicroRNAs in cancer
pcad05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102990689 (NOTCH2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102990689 (NOTCH2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102990689 (NOTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102990689 (NOTCH2)
   05206 MicroRNAs in cancer
    102990689 (NOTCH2)
  09162 Cancer: specific types
   05224 Breast cancer
    102990689 (NOTCH2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102990689 (NOTCH2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102990689 (NOTCH2)
SSDB
Motif
Pfam: EGF hEGF EGF_CA DUF3454 Notch EGF_2 NOD Ank_2 Ank Ank_5 NODP Ank_3 Ank_4 EGF_3 cEGF
Other DBs
NCBI-GeneID: 102990689
NCBI-ProteinID: XP_023975560
UniProt: A0A2Y9SGX7
LinkDB
Position
4
AA seq 2471 aa
MPALRPAPLWALLALWLCRATPARALQCRDGYEPCVNEGICVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCQCAPGFTGEDCQYSTTHPCFVSHPCLNGGA
CHVLSRDTYECTCQVGFTGKLCQWTDTCLSQPCANGSTCTTVANQFSCTCLAGFTGQKCA
SDVNECDVPGQCQHGGTCLNLPGSYQCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTG
DFAFECNCLPGFEGVTCEWNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGGDCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCKNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSGPCLNEGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASSPCVHGVCM
DGVNRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQ
VNECLSNPCVHGNCTGGLSGYKCLCDAGWVGINCEVDRNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCLVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAGVCKEAPNFESYTCLCSPGWQGQRCTVDIDECVSKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCVDGVNTFSCLCLPGFTGDRCQTDMDECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCENNIDECTESSCFNSGTCIDGINSFSCLCPVGFTGP
FCLHEINECNSHPCLNEGVCVDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCIQ
EKAQSRCLCPSGWAGAYCDVPNVSCEVAASHRGVTVDRLCQHSGICISAGNSHHCQCPLG
YTGSYCEDQLDECSSNPCQHGATCRDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCVDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCA
VASNMPDGFICRCSPGFSGARCQSSCGQVKCRRGEQCVHTASGPRCFCPNPQDCNAGCAS
SPCQHGGSCYPQRQPPYYSCKCSPPFWGSHCEFYTAPTSTPPATCLSQYCADKARDGICD
EACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTAECLFDNFECQRNS
KTCKYDKYCADHFKDNHCDQGCNSEACGWDGLDCAADRPENLAQGTLVIVVLMPPEQLLQ
DARSFLRALGTLLHTNLRIKRDAQGDLMVYPYYGEKSAAMKKQRLTRRSLPGDQEQEVAG
SQVFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPKRTQLIY
LLAVAVVIVLFIILLGVIMAKRKRKHGSLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNL
SVQVSEANLIGSGTSEHWVDDEGPQPKKARAEDEALLSEEDDPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDMSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG
KKSRRPNAKSVVPCSLPNLAKEAKEAKGSRRKKSLSDKGQLSESSVTLSPVDSLESPHTY
VSDTTSSPMITSPGILQASPNPVLATAAPPAPVHAQHALSFSNLHEMQPLAHGANTVLPS
VSQLLSHHHIVPPGSGSAGSLGRLHPVTVPADWMNRVEVNETQYNEMFGMVLAPAEGTHP
GITPQSRPPEGKHLPAPREPLPPIVTFQLIPKGSIAQPAGAAQPPSSCPPAVAGTLPTMY
QIPEMARLPSMAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGSQRGPGAHMS
EPPRSNMQVYA
NT seq 7416 nt   +upstreamnt  +downstreamnt
atgcctgccctgcgccccgctccgctgtgggcgctgctggcactgtggctgtgccgcgcg
acccccgcgcgtgcattgcaatgtcgggacggctatgagccctgtgtaaatgaaggaata
tgtgttacctaccacaatggtacagggtactgcaaatgcccagagggattcttgggagaa
tattgtcaacatcgagacccctgtgagaagaaccgctgccagaatggtgggacgtgtgtg
gcccaggctatgttggggaaagccacatgccagtgtgccccgggcttcacaggcgaggac
tgccagtactcgaccactcacccctgctttgtgtctcacccttgcctgaatggaggcgcc
tgccatgtgctgagccgggatacctatgagtgcacctgccaagtcggttttacaggtaaa
ctgtgccaatggactgatacctgtctgtctcagccctgtgcaaatggaagtacctgtacc
actgtggccaaccagttctcctgcacatgcctcgcaggcttcacagggcagaagtgcgcg
agtgatgtcaatgagtgtgacgttccaggacaatgccagcacggtggcacctgcctcaac
ctcccgggttcctatcagtgccagtgcccccagggcttcacaggccagcactgtgacagt
ccctacgtgccctgtgcaccctccccctgtgtcaatggaggcacctgccggcagactggt
gacttcgcctttgagtgcaactgccttccaggttttgaaggggtcacctgtgagtggaat
attgatgactgtcctaatcacaagtgtcagaatggaggggtttgtgtggatggggtcaac
acttacaactgccgctgcccccctcagtggacaggacagttctgcacagaggatgtggat
gagtgcctgctgcaacccaatgcctgtcaaaacgggggcacctgtaccaaccgcaatggg
ggctatggctgtgtgtgcgttaatggctggagtggagatgactgcagtgagaacattgat
gactgcgccttcgcctcctgcactccaggctccacctgcattgatcgtgtggcctccttc
tcttgcatgtgcccagaaggaaaggcaggtctcttatgtcatctggatgatgcatgcatc
agcaacccctgccacaagggggcactgtgtgataccaaccctctgaatgggcagtatatt
tgcacctgtccacaaggctacaaagggggtgactgtacagaagacgtggatgagtgtgcc
atggccaatagcaatccttgtgagcatgcgggaaaatgtgtgaacacagatggtgccttc
cactgtgagtgtctgaagggctatgcagggcctcgttgcgagatggacatcaatgagtgc
cattcagacccctgcaagaatgatgccacctgtctggataagattggaggcttcacatgt
ctgtgcatgccaggtttcaaaggtgtgcattgtgaattggagataaatgaatgtcagagc
aacccttgcgtgaacaatgggcagtgtgtggataaagtcaatcgcttccagtgtctgtgt
ccgcctggtttcactgggccagtttgccagattgatattgatgactgttccagtactcca
tgtctgaatggggcaaagtgtatagatcacccaaatggttatgaatgccagtgcgccaca
ggattcactggtgtgttgtgtgaggagaacatcgacaactgtgaccctgatccttgccac
catggccagtgtcaggatgggattgattcctacacctgcatctgcaatccagggtacatg
ggcgccatctgcagcgaccagatagatgaatgttacagcggcccttgcttgaatgagggt
cgctgcatcgacctggtaaatggttaccagtgcaactgccagccaggcacatcaggtgtt
aattgtgaaatcaattttgatgactgtgcaagtagcccttgtgtccatggagtctgcatg
gatggcgttaatcgttatagctgcgtctgctcaccaggatttacagggcagagatgtaac
attgacattgatgagtgtgcctccaatccctgtcgtaagggtgcaacatgtatcaacgat
gtgaacggtttccgctgtatatgccctgagggaccccatcatcccagctgctactcacag
gtgaacgagtgcctgagcaatccctgtgtccatggaaactgtactgggggtctcagtgga
tacaagtgcctctgtgatgcaggctgggttggcatcaactgtgaagtggacagaaatgaa
tgtctttctaatccatgccagaacggaggaacttgtgacaatctggtgaatggatacagg
tgcacttgcaagaagggctttaaaggctataactgtctggtgaatattgatgaatgtgct
tcgaatccatgtctgaaccaaggaacctgctttgatgatataagtggttatacctgccac
tgtgtgctgccatacacaggcaagaactgtcagactgtattagctccctgttccccaaac
ccttgtgagaatgctggtgtttgcaaagaggcaccaaattttgagagttacacctgcctg
tgttctcctggctggcaaggtcaacgatgtacagttgacattgatgagtgtgtctccaag
ccctgcatgaaccacggtctctgccataacacccagggcagctacatgtgcgagtgtcct
ccaggcttcagtggtatggactgtgaagaggacatcgatgactgccttgccaatccttgc
cagaatggaggttcctgtgtagacggagtgaatactttctcctgcctatgccttccgggc
ttcactggggacaggtgtcagacagacatggatgagtgtctgagtgaaccctgtaagaat
ggagggacctgctctgactatgtcaacagttacacctgcaagtgccaggcgggatttgat
ggagtccactgtgagaacaacattgacgagtgcactgagagctcctgtttcaacagtggc
acatgtattgatgggattaactccttctcttgcttgtgccctgtgggcttcactggcccc
ttctgcctccatgagatcaatgaatgcaactctcatccatgcctgaatgaaggagtatgt
gttgatggcctgggtacctaccgctgcatctgcccattgggctacactgggaaaaactgt
cagaccctggtgaacctctgtagtcggtctccatgtaaaaacaaaggtacttgcattcag
gaaaaagcacagtcccggtgcctgtgtccatctggatgggctggtgcttactgtgacgtg
cccaatgtctcctgtgaggttgcagcctcccacagaggggtgaccgttgaccgcttgtgc
cagcactcaggcatctgtatcagtgctggcaactcacatcactgccagtgccccctgggc
tacaccgggagctactgtgaggatcagcttgatgagtgctcatccaacccctgccagcac
ggagccacctgcagggacttcattggtggatacagatgtgagtgtgtcccaggatatcag
ggtgtcaattgcgagtatgaagtggatgagtgccagaaccagccatgccagaatggaggc
acctgtatcgaccttgtgaaccatttcaagtgctcctgcccaccaggcactcggggcctg
ctttgtgaagagaacattgatgactgtgccaggggtccccactgccttaatggcggtcag
tgtgtggataggattgggggctacagttgtcgctgcttgcctggctttgctggagagcgg
tgtgagggggacatcaacgagtgcctctccaacccctgcagctctgagggcagcctagac
tgcatacagcttaccaatgactacctgtgtgtctgccgcagtgcctttactggtcgtcac
tgtgaaactttcgtcgatgtgtgtccccagatgccttgcctgaatggagggacttgtgct
gtggccagcaacatgcctgatggtttcatttgtcgttgttccccgggattctctggggcg
agatgccagagcagctgtggacaagtgaagtgtaggagaggggagcagtgtgtgcacaca
gcctcaggaccccgctgcttctgccccaacccccaggactgcaacgcaggctgtgccagt
agcccctgccagcacgggggcagctgctaccctcagcgccagcctccttattactcttgc
aagtgttctccgccgttctggggcagccactgtgaattctacacagctcccaccagcacc
cctcctgccacctgtctgagccagtattgtgccgacaaagctcgggatggcatctgcgat
gaggcctgcaacagccatgcctgccagtgggatgggggtgactgttccctcaccatggag
aacccctgggccaactgctcctccccgcttccctgctgggattacatcaacaaccagtgt
gatgagctgtgcaacacggctgagtgcctgtttgacaactttgaatgccagaggaatagc
aagacatgcaaatatgacaaatactgtgcagaccacttcaaagacaaccattgtgaccag
ggatgcaacagtgaggcgtgcggctgggacgggctggactgtgctgctgaccggccagaa
aacctggcacagggtaccctggtcattgtggtgctgatgccacctgaacaactgctccag
gatgctcgcagcttcttgcgggcgctgggcaccctgctccacaccaacctacgcatcaaa
cgggatgcccagggggacctcatggtctacccctattatggtgaaaagtcagctgccatg
aagaagcagagattgacgcgcaggtcccttcctggcgatcaagaacaggaagtggctggc
tctcaggtattcctggaaattgacaaccgccagtgtgttcaagattcagaccagtgcttc
aagaatacggatgcagcagcagctcttctggcatctcacgccatccaggggaccctgtcg
taccctcttgtgtctgttgtcagtgaatccctgaccccaaaacgcacccagcttatctat
ctacttgctgttgctgttgttattgtcttgtttattatcctgctgggggttatcatggca
aaacgaaagcgtaagcatggttccctctggctgcctgaaggcttcacccttcgccgtgac
tccagcaatcacaaacgtcgcgagccagtgggacaggatgccgtggggctgaaaaatctc
tcagtgcaagtctcagaggctaacctaattggttctggaacaagtgaacattgggtcgac
gatgaagggccccagccaaagaaagccagggctgaagatgaggctttactctcagaagaa
gatgatcccatcgatcgacggccatggacacagcagcaccttgaagctgcagatatccgt
aggacaccgtctttggctctcactcctccgcaggcagagcaggaagtggatgtgctggat
gttaacgtccgcggcccagatgggtgcaccccactgatgctggcttctctccgaggaggc
agctcagatatgagtgatgaagatgaagatgcagaggactcttccgccaacatcatcaca
gacttggtctaccagggtgccagcctccaagcccagacagaccggactggtgagatggcc
ctgcatcttgcagcccgctactcgagggccgatgctgccaagcgcctcctggatgcgggt
gcagatgccaatgcccaggacaacatgggccgctgccctctccatgctgcagtggcagct
gatgcccaaggtgtcttccagatactgatccgcaaccgagtaactgatctagatgccagg
atgaatgatggcaccacacccctgatcctggctgcccgcctagctgtggagggaatggtg
gcagagttgatcaactgccaagcagatgtgaatgcagtggatgaccacggaaaatctgct
cttcactgggcagctgctgtgaataatgtggaggcgacccttttgctgttgaaaaatggg
gccaaccgagacatgcaggacaacaaggaagagacccctctgtttcttgctgcccgggag
gggagctatgaagcagccaagatcctgttagaccattttgccaatcgggacatcacagac
cacatggatcgtcttccccgggacgtggctcgggaccgcatgcaccatgacattgtgcgc
ctgctggatgagtacaatgtgaccccgagccctccaggcaccgtgctgacttctgctctg
tcacctgtcatctgtggacccaacagatcttttctcagtctgaagcacaccccgatgggc
aagaagtctagacggcccaatgccaagagtgttgtgccctgtagcctccctaaccttgcc
aaggaggccaaggaggccaaggggagtaggaggaagaagtctctgagtgacaagggccag
ttgtctgagagctcagtgactctgtcccccgtcgattccctagaatctcctcacacatat
gtttctgataccacatcctctccgatgattacatcccccgggatcttacaggcctcaccc
aaccctgtgttggccactgctgccccccctgccccagtccatgcacagcatgcactgtct
ttctctaaccttcatgagatgcagcccttggctcacggggccaacactgtgcttccctca
gtgagccagctgctgtcacaccaccacattgttcccccaggcagtggcagtgcggggagc
ttgggtaggctacatccagtcactgtcccagcggactggatgaaccgtgtggaggtgaat
gagacccagtacaacgagatgtttggtatggtcctggctccagctgagggcactcaccct
ggcataactccccagagcaggccgcctgaagggaagcatttacctgcccctcgagagccc
ttgccccccatcgtgactttccagctaatccccaaaggcagcattgcccaaccagccggg
gctgcccagcctccgtccagctgccctccagctgttgcaggcaccctgcccaccatgtat
cagattccagaaatggctcgtttgcccagtatggcttttcccactgccatgatgccccag
caggatgggcaggttgctcagaccattctcccagcctaccatccctttccagcctctgtg
ggcaagtatcccacacccccttcacagcatagctatgcttcctccaatgctgctgagaga
acgcccagtcacagtggtcacctccagggtgagcatccctacctgacaccatcccccgag
tctcctgaccagtggtcaagttcatccccccactctgcttctgactggtcagatgtgacc
accagccccactcctgggggtgctggaggaagtcagcggggacctggggcacacatgtct
gagccaccacgcagcaacatgcaggtctatgcatga

DBGET integrated database retrieval system