KEGG   Physeter catodon (sperm whale): 102974655
Entry
102974655         CDS       T06011                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad01524  Platinum drug resistance
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04022  cGMP-PKG signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04140  Autophagy - animal
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04370  VEGF signaling pathway
pcad04510  Focal adhesion
pcad04722  Neurotrophin signaling pathway
pcad04910  Insulin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad05010  Alzheimer disease
pcad05014  Amyotrophic lateral sclerosis
pcad05020  Prion disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05145  Toxoplasmosis
pcad05152  Tuberculosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05165  Human papillomavirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
pcad05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102974655 (BAD)
   04014 Ras signaling pathway
    102974655 (BAD)
   04370 VEGF signaling pathway
    102974655 (BAD)
   04024 cAMP signaling pathway
    102974655 (BAD)
   04022 cGMP-PKG signaling pathway
    102974655 (BAD)
   04151 PI3K-Akt signaling pathway
    102974655 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102974655 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    102974655 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102974655 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102974655 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102974655 (BAD)
   04919 Thyroid hormone signaling pathway
    102974655 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102974655 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102974655 (BAD)
   05203 Viral carcinogenesis
    102974655 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102974655 (BAD)
   05212 Pancreatic cancer
    102974655 (BAD)
   05225 Hepatocellular carcinoma
    102974655 (BAD)
   05221 Acute myeloid leukemia
    102974655 (BAD)
   05220 Chronic myeloid leukemia
    102974655 (BAD)
   05218 Melanoma
    102974655 (BAD)
   05211 Renal cell carcinoma
    102974655 (BAD)
   05215 Prostate cancer
    102974655 (BAD)
   05213 Endometrial cancer
    102974655 (BAD)
   05223 Non-small cell lung cancer
    102974655 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102974655 (BAD)
   05014 Amyotrophic lateral sclerosis
    102974655 (BAD)
   05020 Prion disease
    102974655 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    102974655 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102974655 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102974655 (BAD)
   05161 Hepatitis B
    102974655 (BAD)
   05160 Hepatitis C
    102974655 (BAD)
   05162 Measles
    102974655 (BAD)
   05168 Herpes simplex virus 1 infection
    102974655 (BAD)
   05165 Human papillomavirus infection
    102974655 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102974655 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102974655 (BAD)
   01524 Platinum drug resistance
    102974655 (BAD)
   01522 Endocrine resistance
    102974655 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 102974655
NCBI-ProteinID: XP_007102661
UniProt: A0A2Y9EHU3
LinkDB
Position
Unknown
AA seq 168 aa
MFQIPEFEQSEQEDSSPADRGLGPSPTGDKPPGPSKHRQTAPGLLGEAGHQQGQPASSSH
HGGTGAVDTRSRHSSYSAGTEDDEGTEEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSD
EFHGSFKGLPRPKSAGTATQMRQSPSWTRFLQSWWNRNLGRGGPAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcagagtgagcaggaagactccagccctgcagatagg
ggcctgggccccagccccacaggggacaagcccccaggtcccagcaagcaccggcaaacg
gccccaggcctcctgggggaagctggtcaccagcaggggcagccagccagcagcagccac
catggaggcactggtgctgtggacacccggagtcgccacagctcctactccgcggggacg
gaggatgacgaagggacggaggaggaggagcccagcccctttcggggccgctcgcgctcg
gcaccccccaacctctgggctgcacagcgatatggccgcgagctccggaggatgagcgac
gagttccacggctccttcaaaggacttcctcgcccgaagagcgcgggcacagcgacgcag
atgcgacaaagccccagctggacgcgcttccttcagtcctggtggaaccggaacttgggg
agaggaggccccgccccctcccagtga

DBGET integrated database retrieval system