KEGG   Physeter catodon (sperm whale): 102974987
Entry
102974987         CDS       T06011                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04064  NF-kappa B signaling pathway
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04115  p53 signaling pathway
pcad04210  Apoptosis
pcad04218  Cellular senescence
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05216  Thyroid cancer
pcad05217  Basal cell carcinoma
pcad05218  Melanoma
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102974987 (GADD45A)
   04064 NF-kappa B signaling pathway
    102974987 (GADD45A)
   04068 FoxO signaling pathway
    102974987 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102974987 (GADD45A)
   04210 Apoptosis
    102974987 (GADD45A)
   04115 p53 signaling pathway
    102974987 (GADD45A)
   04218 Cellular senescence
    102974987 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102974987 (GADD45A)
   05202 Transcriptional misregulation in cancer
    102974987 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102974987 (GADD45A)
   05212 Pancreatic cancer
    102974987 (GADD45A)
   05225 Hepatocellular carcinoma
    102974987 (GADD45A)
   05226 Gastric cancer
    102974987 (GADD45A)
   05214 Glioma
    102974987 (GADD45A)
   05216 Thyroid cancer
    102974987 (GADD45A)
   05220 Chronic myeloid leukemia
    102974987 (GADD45A)
   05217 Basal cell carcinoma
    102974987 (GADD45A)
   05218 Melanoma
    102974987 (GADD45A)
   05213 Endometrial cancer
    102974987 (GADD45A)
   05224 Breast cancer
    102974987 (GADD45A)
   05222 Small cell lung cancer
    102974987 (GADD45A)
   05223 Non-small cell lung cancer
    102974987 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102974987 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcad03036]
    102974987 (GADD45A)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102974987 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102974987 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102974987
NCBI-ProteinID: XP_007114947
UniProt: A0A2Y9F4H1
LinkDB
Position
4
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDIDILRVSNPGRLAELLLLESDAGPALSEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggataaggtgggg
gatgcccttgaggaagtgctcagcaaagccctgagtcagcgcaccatcaccgtcggggtg
tacgaggcggccaagctgctcaacgtcgaccccgataacgtggtgctgtgcctgctggcg
gcggacgaggacgacgacagggacgtggctctgcagatccacttcaccctgatccaggcg
ttctgctgcgagaacgacatcgacatcctgcgcgtcagcaaccctggccggctggccgag
ctcctgctcctggagagtgacgcgggccccgcgttgagcgagggcgcggagcagcccccg
gacttgcactgcgtgctggtgacgaatccacattcatcacagtggaaggaccctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggttccagtgatt
aatctccctgaacggtga

KEGG   Physeter catodon (sperm whale): 102986518
Entry
102986518         CDS       T06011                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04064  NF-kappa B signaling pathway
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04115  p53 signaling pathway
pcad04210  Apoptosis
pcad04218  Cellular senescence
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05216  Thyroid cancer
pcad05217  Basal cell carcinoma
pcad05218  Melanoma
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102986518 (GADD45G)
   04064 NF-kappa B signaling pathway
    102986518 (GADD45G)
   04068 FoxO signaling pathway
    102986518 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102986518 (GADD45G)
   04210 Apoptosis
    102986518 (GADD45G)
   04115 p53 signaling pathway
    102986518 (GADD45G)
   04218 Cellular senescence
    102986518 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102986518 (GADD45G)
   05202 Transcriptional misregulation in cancer
    102986518 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102986518 (GADD45G)
   05212 Pancreatic cancer
    102986518 (GADD45G)
   05225 Hepatocellular carcinoma
    102986518 (GADD45G)
   05226 Gastric cancer
    102986518 (GADD45G)
   05214 Glioma
    102986518 (GADD45G)
   05216 Thyroid cancer
    102986518 (GADD45G)
   05220 Chronic myeloid leukemia
    102986518 (GADD45G)
   05217 Basal cell carcinoma
    102986518 (GADD45G)
   05218 Melanoma
    102986518 (GADD45G)
   05213 Endometrial cancer
    102986518 (GADD45G)
   05224 Breast cancer
    102986518 (GADD45G)
   05222 Small cell lung cancer
    102986518 (GADD45G)
   05223 Non-small cell lung cancer
    102986518 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102986518 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcad03036]
    102986518 (GADD45G)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102986518 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102986518 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102986518
NCBI-ProteinID: XP_007104757
UniProt: A0A2Y9ELA7
LinkDB
Position
Unknown
AA seq 159 aa
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGTGDEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPNITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagttcgcggccaggacacggttcccgaaagcacggccaggatgcag
ggcgccgggaaagcgctgcacgagctgctgctgtctgcgcaacgccagggttgcctcacc
gccggcgtctacgagtccgccaaagttctgaacgtggaccccgacaacgtgaccttctgc
gtgctggccgccgacgaggaggacgagggcgacatcgcgctgcagatccacttcactttg
atccaggcgttctgctgtgagaacgacatagacatcgtgcgcgtgggcgacgtgcagagg
ctggcggcgatcgtgggtaccggcgacgaggcgggtgcgccgggggacctgcactgcatc
ctcatttcgaaccccaacgaggacgcatggaaggaccccgccttggagaaactcagcctg
ttctgcgaggagagtcgcagcgtcaacgactgggtgcccaatatcaccctccccgagtga

KEGG   Physeter catodon (sperm whale): 102993403
Entry
102993403         CDS       T06011                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04064  NF-kappa B signaling pathway
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04115  p53 signaling pathway
pcad04210  Apoptosis
pcad04218  Cellular senescence
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05216  Thyroid cancer
pcad05217  Basal cell carcinoma
pcad05218  Melanoma
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102993403 (GADD45B)
   04064 NF-kappa B signaling pathway
    102993403 (GADD45B)
   04068 FoxO signaling pathway
    102993403 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102993403 (GADD45B)
   04210 Apoptosis
    102993403 (GADD45B)
   04115 p53 signaling pathway
    102993403 (GADD45B)
   04218 Cellular senescence
    102993403 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102993403 (GADD45B)
   05202 Transcriptional misregulation in cancer
    102993403 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102993403 (GADD45B)
   05212 Pancreatic cancer
    102993403 (GADD45B)
   05225 Hepatocellular carcinoma
    102993403 (GADD45B)
   05226 Gastric cancer
    102993403 (GADD45B)
   05214 Glioma
    102993403 (GADD45B)
   05216 Thyroid cancer
    102993403 (GADD45B)
   05220 Chronic myeloid leukemia
    102993403 (GADD45B)
   05217 Basal cell carcinoma
    102993403 (GADD45B)
   05218 Melanoma
    102993403 (GADD45B)
   05213 Endometrial cancer
    102993403 (GADD45B)
   05224 Breast cancer
    102993403 (GADD45B)
   05222 Small cell lung cancer
    102993403 (GADD45B)
   05223 Non-small cell lung cancer
    102993403 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102993403 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcad03036]
    102993403 (GADD45B)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102993403 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102993403 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102993403
NCBI-ProteinID: XP_023990193
UniProt: A0A2Y9TIL2
LinkDB
Position
Unknown
AA seq 160 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRENNQWVPYIPLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacactggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagaccgtgagc
gccgcggtggaggagctgctggtggccgcgcagcgccaggaccgcctcaccgtgggggtg
tacgagtcggccaagctgatgaatgtggaccctgacagcgtggtcctgtgcctcctggct
attgacgaggaggaggaggacgatatcgccctgcagatccacttcacgctcatccagtcc
ttttgctgtgacaacgacattgacatcgtgcgggtgtcaggaatgcagcgcctggcacag
ctgctgggcgagccggccgagactcagggcaccaccgaggcccgggacctgcactgcctc
ctggtcacgaaccctcacacagacgcctggaaaagccacggcctggtggaggttgccagt
tactgcgaagagagcagggagaacaaccagtgggtcccctacatccccctccaggagcgc
tga

DBGET integrated database retrieval system