KEGG   Physeter catodon (sperm whale): 102975335
Entry
102975335         CDS       T06011                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04020  Calcium signaling pathway
pcad04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102975335 (CACNA1E)
   04020 Calcium signaling pathway
    102975335 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102975335 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pcad04040]
    102975335 (CACNA1E)
Ion channels [BR:pcad04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102975335 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 102975335
NCBI-ProteinID: XP_007105843
UniProt: A0A2Y9ENQ1
LinkDB
Position
4
AA seq 2309 aa
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMPSQEALNKEEAPPMNPLNPLNPLSSLHPLNAHPSLYRRPRPIEGPALGL
GLEKCEEERVSRGGSLQGDGGDLSSALDDQRSPLSLGKREPPWLARPCHGNCDPTQQEAG
GGETVVAFEDRARHRQSQRRSRHRRVRTEGKESSSASRSRSASQERSLDEAVPGEGERNL
EPRDSHGGKEPAIREEGRSQDLRRTNSLMMPRGSGLAGAFDEADTPLVLPQPELEAEKDA
ALTEQEPEGSSEQALLGDVQLDMGRVISQSEPDLSCVTANTDKAATESTSVTVAIPDVGP
LVDSTVVHISSKTDGEASPLKESEIKEDEEEVEKEKRETGKAMVPHSSMFIFSTTNPIRR
ACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIK
MIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLR
PLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKD
TEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDV
TEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNER
ACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPC
TYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKL
VNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAII
GMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTA
PSGQSESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEF
VRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVH
FTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASDLT
VGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQD
PVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQPSNHGIY
LPSDTQEHAGSGRASSMPRLTVDPQVVTDPSSMRRSFSTIREKRSNSSWLEEFSMERSSE
NTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEE
RGTQADWESPERHQSRSPSEGRSQTPNRPGTGSLSESSIPSVSDTSTPRRSRRQLPPVPP
KPRPLLSYSSLIRHPGSISPPADGSEGGSPLTSQALEGNDASLPESSNPRYVQRGHPSSP
QRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYR
RRRRGGPGPGMMCGAVSDLLSDTEEDDKC
NT seq 6930 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccggggtcgggagatggagattcggac
cagagcaggaaccggcaaggaacccccgtgccggcctccgggccggcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccctattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccgtttgagtacatgatcttggccaccatcatt
gccaactgcatcgtcttggccctggagcagcatcttcctgaggatgacaagaccccaatg
tcccgcagactggagaagacagaaccgtatttcatcgggatcttttgctttgaagctggg
atcaaaatcgtagccctggggttcatcttccataagggctcgtacctccgcaacggctgg
aatgtcatggacttcatcgtggtcctcagtggcatcctggccactgcgggaacccacttc
aacacacatgtggacctgaggacgctccgggctgtgcgtgtcctaaggcccctgaagctc
gtgtcggggatacctagcctgcagattgtgttgaagtccatcatgaaggccatggtgcct
cttctgcagattggccttctgctcttctttgccatcctgatgtttgctatcattggcttg
gagttctacagcgggaagttgcaccgagcttgcttcatgaacaattcaggtattctagaa
ggatttgacccccctcacccatgtggtgtgcagggctgcccagctggttatgaatgccgg
gactggatcggccccaatgatgggatcacccagtttgataacatcctttttgctgtgctg
actgtcttccagtgcatcaccatggaagggtggaccactgtgctgtacaataccaatgat
gccttaggagccacctggaattggctgtacttcatccccctgatcataattggatccttc
tttgttctcaacctcgtcctgggagtgctttctggggaatttgccaaagagagagagaga
gtggagaaccggagagctttcatgaaactgcggcgccagcagcagatcgagcgtgagctg
aatgggtaccgcgcctggatagacaaagcagaggaagtcatgctcgctgaagaaaataaa
aatgctggaacgtcagccttagaagtgctccgaagggcaaccatcaaaagaagccggaca
gaggccatgacgcgggactccagtgacgagcactgtgtcgacatctcctctgtgggcaca
cccctcgcccgagccagcatcaagagtacaaaggtggacggggcctcctatttccggcac
aaggagcggcttctgcgtatctctatccgccacatggttaaatcccaggtgttttactgg
attgtgctgagccttgtggctctcaacaccgcctgtgtggccatcgtccatcacaaccag
ccccagtggctcacccaccttctctactatgcagaatttttgtttctgggactcttcctc
ctggagatgtccctgaagatgtacggcatggggcctcgcctttattttcactcttcgttc
aactgctttgattttggggtcacagtgggcagcatctttgaagtggtctgggcgatcttc
agacctggtacatcttttggaatcagtgtcttgcgagctctccggcttctaagaatattt
aaaataaccaagtattgggcatccctgcggaatttggtggtctccttgatgagttccatg
aagtcaatcatcagtttgctcttccttctcttcctcttcatcgttgtctttgctctccta
ggaatgcagctgtttggaggcaggttcaactttaacgatgggactccttcagcaaacttt
gacaccttccctgcagccatcatgactgtattccagatcctgacgggtgaggactggaat
gaggtgatgtacaatgggatccgctcccagggtggggtcagctcaggcatgtggtcagct
atctacttcattgtgctcaccttgtttggaaactatacactgctgaatgtgttcttggcc
atcgctgtggacaatctggccaatgcccaggagctgaccaaggatgaacaggaagaagag
gaggccttcaaccagaaacacgcgctgcagaaggccaaggaggtcagcccgatgtctgca
cccaacatgccttccatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagggagcgaaggcgccgacaccacatgtcggtgtgggagcag
cgcaccagccagctgagaaggcacatgcagatgcccagccaggaggccctcaacaaggag
gaggccccgcccatgaaccccctcaaccccctcaaccccctgagctccctccacccgctc
aatgcccaccccagcctctaccggagacccaggcccatcgaggggccggccctgggcctg
ggtctggagaagtgtgaggaagagcgcgtcagccgcggggggtccctccagggggacgga
ggggacctgtcgagtgccctggacgaccagaggagccccctgtccctgggcaaacgggag
ccgccctggctggccaggccctgtcatgggaactgtgacccgacccagcaggaggccggg
ggcggggagaccgtggtggccttcgaggaccgggccaggcacaggcagagccagcggcgc
agccggcaccgccgcgtcaggacggagggcaaggagtcctcctccgcttccaggagcagg
tctgccagccaggagcggagtctggatgaagctgtgcccggtgagggggagaggaacctc
gagcccagggacagccacgggggcaaggagcccgccatccgggaggaagggcgatcccag
gacttaaggaggaccaatagtctgatgatgcccagaggctccgggctggcaggagcattt
gacgaggccgacacacccctcgtcctgccccaaccagagctggaagcggagaaggatgca
gcgctgacggagcaggagccggagggcagcagtgagcaagccctgctgggggacgtgcag
ctggacatgggccgggtcatcagccagagtgagcccgacctctcctgcgtcacggccaac
acggacaaggctgccaccgagagcaccagcgtcaccgtcgccatccccgacgtgggcccc
ttggtggactcgaccgtggtgcacatcagcagcaagactgatggagaagccagtcccttg
aaagagtcagagatcaaagaggatgaggaggaggtggagaaggagaagcgggagacgggc
aaagccatggtgcctcacagctccatgttcatcttcagcaccaccaacccgatccgcagg
gcctgccactacatcgtgaacctgcgctactttgagatgtgcatcctcctggtgatcgca
gccagcagcatcgccctggcggccgaggaccccgtcctgaccaactcggagcgcaacaaa
gtgctgaggtattttgactatgttttcactggcgtcttcacctttgagatggttataaag
atgatagaccagggcttgatcctgcaggatgggtcctacttccgagacctgtggaacatc
ctcgactttgtggtagtggttggtgcattggtggcctttgctctggcgaatgccttggga
accaacaagggccgggacatcaagaccatcaagtccctgcgggtgctgcgtgtgctgaga
ccgctaaagaccatcaagcgcctgcccaagctcaaggctgtcttcgactgtgtggtcacc
tccttgaaaaatgtcttcaacatactaattgtctataagctcttcatgttcatctttgct
gtcatcgcagttcagcttttcaagggcaagttcttctattgcacagacagttccaaggac
acagagaaggagtgcataggaaactatgtagatcatgagaaaaacaagatggaggtgaaa
ggccgagaatggaagcgccatgaattccactatgacaacatcatctgggccctgctgacc
ctcttcaccgtctccacaggggaaggatggcctcaagttttgcagcattctgtcgatgtg
acagaggaagaccgaggcccgagccgcagcaaccgcatggagatgtccatcttttacgtg
gtctactttgtggtctttcctttcttcttcgtcaacatctttgtggctctcatcatcatc
accttccaggagcaaggggacaagatgatggaggagtgcagcctggagaagaacgagagg
gcgtgcatcgacttcgccatcagtgccaaaccactcacccgctacatgccccagaacagg
cacaccttccagtaccgcgtctggcacttcgtggtgtccccatcctttgagtacaccatc
atggccatgatcgccctgaacaccgtcgtgctgatgatgaagtactactctgctccctgt
acctatgaactggccctgaagtacctgaatatcgccttcaccatggtgttctccctggaa
tgtgtcctaaagatcattgcgtttggcttcttgaactatttccgagacacctggaatatc
tttgacttcatcaccgtgatcggcagtatcacagaaattattctgacagacagcaagctg
gtgaacaccagtggcttcaatatgagctttctgaagctcttccgagccgcccgcctcatc
aagcttctgcgtcaaggctacaccatccgtattttactttggaccttcgtgcagtccttt
aaggccctcccctacgtctgccttctgattgccatgcttttcttcatctatgccatcatt
gggatgcaggtctttggaaacataaaattagatgaggagagtcacatcaaccggcacaac
aacttccggagtttctttgggtccctcatgctactcttcaggagtgccacgggtgaggcc
tggcaggagataatgctgtcgtgcctcggggagaagggctgtgagcctgacaccaccgca
ccctcagggcagagtgagagcgagcgctgtggcaccgacctggcctacgtgtacttcgtc
tccttcatcttcttttgttccttcttgatgctcaacctgttcgtggccgtcatcatggac
aactttgagtacctgactcgggactcatccatcctggggcctcaccacctggacgagttt
gtccgtgtctgggcagagtatgacagagcggcatgtggccgcatccattacactgagatg
tatgaaatgctgactctcatgtcaccaccgctaggcctcggcaagagatgtccctccaag
gtggcatataagaggttagtcctgatgaatatgccggtggctgaggacatgactgtccac
ttcacttccacgcttatggctctgatccggacagctctggacattaaaatcgccaaaggt
ggtgcggacaggcagcagctagactcagagctacagaaggagaccctggccatctggcct
cacctgtcccagaagatgttagatctgcttgtgcccatgcccaaagcctccgacctgact
gtgggcaaaatctatgcagcaatgatgatcatggactactataaacagagcaaggtgaag
aagcagaggcagcagctggaggaacagaaaaacgcacccatgttccagcggatggagccg
tcatctctgcctcaggagatcattgctaatgccaaagccctgccttatctccagcaggac
cccgtttcaggcctgagtggccggagtggatacccttcgatgagtccactctccccgcag
gaaatattccagttggcctgtatggacccagctgatgatggacaattccaggaacagcaa
tctctggagccagaggttagtgaattaaaaagcgtgcagccctctaaccatggcatctac
cttccttcggacacccaggagcatgcgggatctgggagggcatcctctatgccacgcctg
actgtggatccccaggtggtgacagaccctagctccatgagacgttcattttccactatt
cgggaaaagcgttcaaattcctcttggctggaggaattctccatggagcgaagcagcgaa
aacacctacaagtcgcgtcgccggagttaccactcctccctgaggctgtcagcccaccgc
ctgaactctgactcaggccacaagtccgacacccaccgctcagggggcagagagcgggga
cgatcgaaagagcgaaagcatcttctctctcccgacgtctcccgttgcaactccgaggag
cgagggacccaggccgactgggagtccccagaacgtcatcagtcccggtctcccagcgag
ggcaggtcacagacccccaacagaccgggcacagggtccctcagtgaaagctccatcccc
tccgtctccgacaccagcaccccaagacgaagtcgtcggcagctcccacctgtccctcca
aagcctcggcccctcctttcctacagctccctgataagacaccctgggagcatctcccca
cctgccgatgggagcgagggtggctccccactgacctcccaagctctggagggcaatgac
gccagcctgcccgagtcttccaacccccggtacgtacagcggggccacccctcctcccca
cagcgctacatctctgagccctacctggccctgcacgaagactcccacgcctcggactgt
ggcgaggaggagacgctcacctttgaagcagctgtggctaccagcctcggccggtccaac
accatcggctccgccccgcccctgcggcacagctggcagatgcccaacgggcactatcgg
cggcggaggcgcggggggcctggaccaggcatgatgtgtggagctgtcagcgaccttctg
agcgatacggaagaagacgacaaatgctag

DBGET integrated database retrieval system