KEGG   Physeter catodon (sperm whale): 102975467
Entry
102975467         CDS       T06011                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X3
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04020  Calcium signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04068  FoxO signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04144  Endocytosis
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04520  Adherens junction
pcad04540  Gap junction
pcad04630  JAK-STAT signaling pathway
pcad04810  Regulation of actin cytoskeleton
pcad04912  GnRH signaling pathway
pcad04915  Estrogen signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04926  Relaxin signaling pathway
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04934  Cushing syndrome
pcad05160  Hepatitis C
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102975467 (EGFR)
   04012 ErbB signaling pathway
    102975467 (EGFR)
   04014 Ras signaling pathway
    102975467 (EGFR)
   04015 Rap1 signaling pathway
    102975467 (EGFR)
   04630 JAK-STAT signaling pathway
    102975467 (EGFR)
   04066 HIF-1 signaling pathway
    102975467 (EGFR)
   04068 FoxO signaling pathway
    102975467 (EGFR)
   04020 Calcium signaling pathway
    102975467 (EGFR)
   04072 Phospholipase D signaling pathway
    102975467 (EGFR)
   04151 PI3K-Akt signaling pathway
    102975467 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102975467 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102975467 (EGFR)
   04520 Adherens junction
    102975467 (EGFR)
   04540 Gap junction
    102975467 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102975467 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102975467 (EGFR)
   04915 Estrogen signaling pathway
    102975467 (EGFR)
   04921 Oxytocin signaling pathway
    102975467 (EGFR)
   04926 Relaxin signaling pathway
    102975467 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    102975467 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102975467 (EGFR)
   05206 MicroRNAs in cancer
    102975467 (EGFR)
   05205 Proteoglycans in cancer
    102975467 (EGFR)
   05230 Central carbon metabolism in cancer
    102975467 (EGFR)
   05231 Choline metabolism in cancer
    102975467 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102975467 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102975467 (EGFR)
   05212 Pancreatic cancer
    102975467 (EGFR)
   05225 Hepatocellular carcinoma
    102975467 (EGFR)
   05226 Gastric cancer
    102975467 (EGFR)
   05214 Glioma
    102975467 (EGFR)
   05218 Melanoma
    102975467 (EGFR)
   05219 Bladder cancer
    102975467 (EGFR)
   05215 Prostate cancer
    102975467 (EGFR)
   05213 Endometrial cancer
    102975467 (EGFR)
   05224 Breast cancer
    102975467 (EGFR)
   05223 Non-small cell lung cancer
    102975467 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102975467 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102975467 (EGFR)
   05171 Coronavirus disease - COVID-19
    102975467 (EGFR)
   05163 Human cytomegalovirus infection
    102975467 (EGFR)
   05165 Human papillomavirus infection
    102975467 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102975467 (EGFR)
   01522 Endocrine resistance
    102975467 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102975467 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102975467 (EGFR)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102975467 (EGFR)
Protein kinases [BR:pcad01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102975467 (EGFR)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102975467 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   102975467 (EGFR)
  Exosomal proteins of bladder cancer cells
   102975467 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr GF_recep_IV Recep_L_domain Pkinase Furin-like APH Kinase-like Borrelia_P83 Kdo
Other DBs
NCBI-GeneID: 102975467
NCBI-ProteinID: XP_007112084
UniProt: A0A2Y9F1C6
LinkDB
Position
5
AA seq 1125 aa
MFNNCEVVLGNLEITYMQSSYDLSFLKTIQEVAGYVLIALNTAEKIPLEKLQIIRGNVLY
ESTHALAVLSNYGANKTGLRELPMRNLQEILQGAVRFRNNPVLCNMGTVQWRDIVNTDFL
SNMSMEFQDQLGRCPKCDPVCLNGSCWGAGKENCQKLTKVICAQQCSGRCRGRSPSDCCH
SQCAAGCTGPRESDCLVCRRFRDGATCKDTCPPLMLYDPTTYEMKVNPLGKYSFGATCVR
KCPRNYVVTDHGSCVRACSSDSQEVEEDGVRKCKKCDGPCGKVCNGIGIGEFKDTLSINA
TNIKHFRNCTSISGDLHILPVAFRGDSFTRTPPLDPKELDILKTVKEITGFLLIQAWPAN
RTGLHAFENLEIIRGRTKQHGNRKLCYADTINWRKLFGTSSQKTKIINNRSEKECKAMGH
VCNPLCSSEGCWGPKPKDCVSCRNFSRGKECVEKCNILKGEPREFVENSECVQCHPECLP
QAMNVTCTGHGPGSCVKCAHNIDGPHCVKTCPAGVTGENSTLIWKYADANHVCHLCHPSC
TYGCAGPGLEGCAVNGPRIPSIATGIVGALLLAVVLALGVGLFLRRRRIVRKRTLRRLLQ
ERELVEPLTPSGEAPNQALLRILKETELKKVKVLGSGAFGTVYKGLWIPEGEKVKIPVAI
KELREATSPKANKEILDEAYVMASVDNPHVCRLLGVCLTSTVQLITQLMPFGCLLDYVRE
HRDSIGSQHLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGA
EEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEIS
TVLEKGERLPQPPICTIDVYMIMVKCWMIDAESRPKFRELIIEFSKMARDPQRYLVIQGD
ERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQQGFFHSPTTSRTPLLSSLSAASNT
PTVACVDRNGQSYPLKEDSFLQRYSSDPTGALTEDSIDDAFLPAPEYVNQSIPKRPAGSV
QNPVYHNQPLNPAPGREPHYQNSHGNAVDSPEYLSAAHPACTNGVLDGPALWAQKGGHQI
SLDNPAYQQAFLPKEAKSNGIFKGPAAENAEYLRAAPAGSDLTGA
NT seq 3378 nt   +upstreamnt  +downstreamnt
atgttcaataactgtgaggtggtccttgggaatttggaaattacctacatgcaaagtagt
tacgacctttctttcctaaagaccatccaggaggttgctggctatgtactcattgccctc
aacacagcggagaagattcctctggaaaagctgcagatcatcagaggaaatgtgctctat
gaaagcacccatgccctagcggtcttatccaactacggtgcaaataaaacgggactgagg
gagttgcccatgagaaacttacaggagatcctgcaaggcgccgtgcggttcaggaacaac
cctgtcctctgcaacatggggaccgtccagtggagggacatcgtcaacaccgactttctg
agcaacatgtcgatggaatttcaggaccagctgggcagatgcccaaagtgtgatccagtc
tgtcttaatggaagctgctggggtgcggggaaagagaactgccagaaactgaccaaagtc
atctgtgcccagcagtgttccgggcgctgccgcggcaggtcccccagcgactgctgccac
agccagtgtgccgccggctgcacggggccgcgggagagtgactgcctggtctgccgcagg
ttccgggacggagccacgtgcaaggacacatgcccgccactcatgctgtacgaccccacc
acctacgagatgaaagtcaacccgctggggaagtacagcttcggcgccacctgtgtcagg
aagtgcccccgtaactacgtggtgacggaccacggctcgtgcgtccgcgcctgcagctct
gacagccaggaggtggaggaggacggcgtccgcaagtgtaaaaagtgcgacggaccttgt
ggcaaagtttgtaacgggataggaattggtgagtttaaagatacactttccataaatgct
acaaatattaaacacttcagaaattgcacctcgatcagtggagaccttcatatcctgcca
gtagcatttaggggtgattccttcacccgtactccacctctggacccaaaggaactggac
attctaaaaactgtaaaggaaataacagggtttttgctgattcaggcctggcctgcaaac
aggactggcctccatgcttttgagaacctggaaatcatacgtggcaggacaaagcaacat
ggaaaccgaaagttgtgctacgcagatacaataaactggagaaaactctttgggacctca
agtcagaaaaccaaaatcataaacaacaggagtgaaaaagagtgcaaggccatgggccac
gtctgtaaccctctgtgctcgtcagagggctgctggggcccgaaacccaaagactgcgtg
tcctgccgaaacttcagccgtggcaaggagtgtgtggagaagtgcaacattctaaaggga
gagcccagggagttcgttgagaactccgagtgcgtgcagtgccatccggaatgcctgccc
caagccatgaacgtgacctgcacgggacacggaccaggcagctgtgtaaagtgtgcccac
aacatcgacggccctcactgcgtcaagacctgccctgctggagtcacaggagaaaacagc
accctgatctggaagtatgcagatgccaatcacgtgtgtcacctgtgccaccccagctgc
acctacggctgtgctgggccaggtcttgaaggctgtgcagtgaatgggcccaggattccg
tccatcgccaccgggatcgtgggcgccctgctgctggctgtggtgctggccctgggcgtc
ggcctctttctgcgcaggcgccgcatcgtccgcaagcgcacgctgcgccggctgctgcag
gagcgcgagcttgtcgagcctctgacgcccagcggagaagctcccaaccaagctctcttg
aggatcttaaaggagacggaattaaaaaaggtcaaggtgctgggctccggagccttcggc
acggtgtacaagggactctggatcccagaaggcgagaaggttaaaattcctgtggctatc
aaggaattaagagaagccacatctccaaaagccaacaaggagattcttgatgaagcctac
gtgatggccagcgtggacaatcctcacgtgtgccgccttctgggcgtctgcctgacgtcc
acggtacagctcatcacccagctcatgcccttcggctgcctgctggactatgtccgtgag
cacagagacagcatcggctcccagcacctgctcaactggtgcgtgcagatcgcaaagggc
atgaactacctggaggaccggcgcttggtgcaccgagacctggcggccaggaatgtgctg
gtgaagacgccgcagcacgtcaagatcacagacttcgggctggccaaactgctgggcgcc
gaggagaaggagtaccacgcagaagggggcaaagtgcctatcaagtggatggctttggaa
tccattttacaccgaatttatacccaccagagtgatgtctggagctacggagtcaccgtt
tgggagttgatgacctttgggtccaagccttacgacgggatccccgcgagtgagatctca
accgtcctggagaagggagaacgcctgcctcagccgcccatctgcaccatcgacgtctac
atgatcatggtcaagtgctggatgattgatgcagagagtcgcccaaagttccgtgagttg
atcattgaattctccaaaatggcccgagacccccagcgctaccttgtcatccagggggac
gagaggatgcatctgcccagccctacagactccaacttctaccgcgccctgatggacgaa
gaggacatggaggatgtcgtggatgccgatgagtacctcatcccccagcagggcttcttc
cacagccccaccacttcccggacgcccctcctcagttctctgagcgccgccagcaacact
cccactgtggcttgcgttgatagaaacgggcagagctatcccctcaaggaagatagcttc
ttgcagcggtacagctcagaccccactggcgccttgaccgaggatagcatagatgacgcc
ttccttccagcgcccgaatacgtaaaccagtccattcccaaaaggcccgcgggctctgtc
cagaaccccgtctatcacaatcagcctctgaacccggctccaggcagagagcctcactac
cagaattcccacggcaatgccgtcgacagccccgagtatctcagcgccgcccaccccgcc
tgcaccaacggtgtgctcgacggccctgccctctgggcgcagaagggcggccaccagatt
agcctggacaaccctgcctaccagcaggccttccttcccaaggaagccaagtcaaacggc
atctttaagggtcctgccgctgaaaatgcagaatacctgagggcagcaccagcaggcagt
gaccttactggggcctga

DBGET integrated database retrieval system